RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764511|ref|YP_003065518.2| S-adenosyl-methyltransferase MraW [Candidatus Liberibacter asiaticus str. psy62] (341 letters) >gnl|CDD|30623 COG0275, COG0275, Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane]. Length = 314 Score = 349 bits (896), Expect = 9e-97 Identities = 134/306 (43%), Positives = 198/306 (64%), Gaps = 8/306 (2%) Query: 20 HVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGS---NVIALDRDPFAVSCGQE 76 H+PVLL +V+ LL P P + +D T GAGG+SR+ + +I +DRDP A++ +E Sbjct: 7 HIPVLLNEVVELLAPKPDGIYIDGTLGAGGHSRAILEKLPDLGRLIGIDRDPQAIAIAKE 66 Query: 77 TMRDYKEQFSLFQATFSQLQDYVPDKG---VDGVVFDLGVSSMQIDCGDRGFSFQKSGPL 133 ++++ + +L F+ L + + + G VDG++ DLGVSS Q+D +RGFSF+K GPL Sbjct: 67 RLKEFDGRVTLVHGNFANLAEALKELGIGKVDGILLDLGVSSPQLDDAERGFSFRKDGPL 126 Query: 134 DMRMSC-SGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLS 192 DMRM G+SA++VVN + +DL RI GEE+ A RIA AIV+RR+ P +TT++L+ Sbjct: 127 DMRMDQTQGLSAAEVVNTYSEEDLARIFKEYGEERFAKRIARAIVERRKKKPIETTKELA 186 Query: 193 SLIQKTV-YFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFH 251 +I+ + K +IHPATR+FQA+RI+VN+E+EEL + L +A LK GG L V+SFH Sbjct: 187 EIIKSAIPAKEKRKKIHPATRTFQAIRIYVNDELEELEEALEAALDLLKPGGRLAVISFH 246 Query: 252 SLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKL 311 SLEDR+VK FF S + + F+ ITKK ++P++E++ N R+RSAKL Sbjct: 247 SLEDRIVKNFFKELSKPGVPKGLPVTEEGPALKFKLITKKPIMPSEEEIEANPRARSAKL 306 Query: 312 RAGMRT 317 R + Sbjct: 307 RVAEKI 312 >gnl|CDD|110769 pfam01795, Methyltransf_5, MraW methylase family. Members of this family are probably SAM dependent methyltransferases based on Escherichia coli mraW. This family appears to be related to pfam01596. Length = 310 Score = 310 bits (795), Expect = 5e-85 Identities = 133/303 (43%), Positives = 201/303 (66%), Gaps = 11/303 (3%) Query: 20 HVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFC-KMGSN--VIALDRDPFAVSCGQE 76 H+ VLL++V+ LLN P + +D T G GG+S + ++ +I +DRDP A++ +E Sbjct: 4 HISVLLQEVVELLNIKPDGIYIDCTLGGGGHSEAILEQLPEEGRLIGIDRDPQAIANAKE 63 Query: 77 TMRDYKEQFSLFQATFSQLQDYVPDKG---VDGVVFDLGVSSMQIDCGDRGFSFQKSGPL 133 ++ +K + +L + F+ L Y+ + G VDG++FDLGVSS Q+D +RGFSF+ PL Sbjct: 64 RLKPFKGRVTLIHSNFANLFAYLKELGVGKVDGILFDLGVSSPQLDGAERGFSFKHDAPL 123 Query: 134 DMRM-SCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLS 192 DMRM +G++A++V+N + +DL RI GEE+ + RIA AIV+RR+ P +TT++L+ Sbjct: 124 DMRMDQSAGLTAAEVLNTYSEEDLARIFKKYGEERFSKRIARAIVERRKKKPIETTKELA 183 Query: 193 SLIQKTV-YFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFH 251 +I+K V +K +IHPATR+FQA+RI+VN+E+E L + L A L GG L V+SFH Sbjct: 184 EIIKKAVPAKAKRKKIHPATRTFQAIRIYVNDELESLKEALEQAPDLLAPGGRLSVISFH 243 Query: 252 SLEDRLVKKFF--ASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSA 309 SLEDR+VK FF S+ +V A +I P + + ITKK ++P++E++ N RSRSA Sbjct: 244 SLEDRIVKNFFREYSKGCQVPAGLPVILEGLEP-LLKIITKKPILPSEEEIEENPRSRSA 302 Query: 310 KLR 312 KLR Sbjct: 303 KLR 305 >gnl|CDD|37993 KOG2782, KOG2782, KOG2782, Putative SAM dependent methyltransferases [General function prediction only]. Length = 303 Score = 185 bits (470), Expect = 2e-47 Identities = 103/266 (38%), Positives = 145/266 (54%), Gaps = 16/266 (6%) Query: 11 SAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSN--VIALDRDP 68 + HVPV+L++V+ +L+P G+ +D TFGAGG++ S + S ALDRDP Sbjct: 18 ADGDEVPSSHVPVMLDEVLDILSPVRGRSFVDMTFGAGGHTSSILQKHSELKNYALDRDP 77 Query: 69 FAVSCGQE--------TMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDC 120 A T++ FS ++ + + D GVDG++ DLG SSMQ+D Sbjct: 78 VARKLAHFHSDELMHPTLKAVLGNFSYIKSLIADTG--LLDVGVDGILMDLGCSSMQVDN 135 Query: 121 GDRGFSFQKSGPLDMRMSC-SGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKR 179 +RGFS + GPLDMRM + + A D+VN +L R+L GEE + + IVK Sbjct: 136 PERGFSVLQDGPLDMRMDGGASLGAEDIVNSWPESELGRVLRDYGEESNWYLLQNRIVKA 195 Query: 180 RQSAPFQTTQDLSSLIQKTVYFSKNNR---IHPATRSFQALRIFVNNEIEELAQGLRSAE 236 R + +T +L LI+ T S+ R I AT+ FQ LRI VNNE++ L L + Sbjct: 196 RLNGGLHSTGELVDLIRGTSPASRGGRQGWIKTATKVFQGLRIAVNNELKTLQNSLYLSF 255 Query: 237 KALKAGGLLIVVSFHSLEDRLVKKFF 262 L GG L V+SFHSLEDR+VK+ F Sbjct: 256 DVLAPGGRLAVISFHSLEDRVVKRTF 281 >gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]. Length = 432 Score = 38.4 bits (89), Expect = 0.003 Identities = 24/95 (25%), Positives = 34/95 (35%), Gaps = 10/95 (10%) Query: 22 PVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMR-- 79 L E + L A G+ +LD G G + K V ++ P AV QE Sbjct: 279 EKLYETALEWLELAGGERVLDLYCGVGTFGLPLAKRVKKVHGVEISPEAVEAAQENAAAN 338 Query: 80 -DYKEQF---SLFQATFSQLQDYVPDKGVDGVVFD 110 +F + T + + Y PD VV D Sbjct: 339 GIDNVEFIAGDAEEFTPAWWEGYKPDV----VVVD 369 >gnl|CDD|37941 KOG2730, KOG2730, KOG2730, Methylase [General function prediction only]. Length = 263 Score = 37.3 bits (86), Expect = 0.006 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Query: 24 LLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDY 81 + +V+A +N +VI+DA G GG + F G VIA+D DP ++C + Y Sbjct: 85 IANRVVACMNA---EVIVDAFCGVGGNTIQFALQGPYVIAIDIDPVKIACARHNAEVY 139 >gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]. Length = 238 Score = 33.3 bits (76), Expect = 0.097 Identities = 23/107 (21%), Positives = 34/107 (31%), Gaps = 12/107 (11%) Query: 9 MSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMG--SNVIALDR 66 MS +H +I+LL PG +LD G G + K V+ LD Sbjct: 31 MSFGLHRLWRR-------ALISLLGIKPGDKVLDVACGTGDMALLLAKSVGTGEVVGLDI 83 Query: 67 DPFAVSCGQETMRD-YKEQFSLFQATFSQLQDYVPDKGVDGVVFDLG 112 + +E ++ + L PD D V G Sbjct: 84 SESMLEVAREKLKKKGVQNVEFVVGDAENLP--FPDNSFDAVTISFG 128 >gnl|CDD|32409 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1, 4-benzoquinol methylase [Coenzyme metabolism]. Length = 243 Score = 31.8 bits (72), Expect = 0.25 Identities = 14/51 (27%), Positives = 22/51 (43%) Query: 15 HTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALD 65 H I + +V L PG +LD G G S ++G++V +D Sbjct: 38 HKINPLRLDYIREVARLRFDLPGLRVLDVGCGGGILSEPLARLGASVTGID 88 >gnl|CDD|32423 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism]. Length = 187 Score = 30.2 bits (68), Expect = 0.79 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query: 28 VIALLNPAPGKVILDATFGAGGYSRSFCKMGSN--VIALDRDPFAV 71 ++ L P PG + D G G + + G + VIA++RD A+ Sbjct: 26 TLSKLRPRPGDRLWDIGAGTGSITIEWALAGPSGRVIAIERDEEAL 71 >gnl|CDD|100093 cd05800, PGM_like2, This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four structural domains (subdomains) with a centrally located active site formed by four loops, one from each subdomain. All four subdomains are included in this alignment model.. Length = 461 Score = 30.2 bits (69), Expect = 0.84 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Query: 17 IGDHVPVLLEKV-IALLNPAPGKVILDATFGAG-GYSRSFCK-MGSNVIAL--DRDPF 69 D++ L V + + A KV++D +GAG GY + G +V + +RDP Sbjct: 153 KPDYLEALRSLVDLEAIREAGLKVVVDPMYGAGAGYLEELLRGAGVDVEEIRAERDPL 210 >gnl|CDD|32588 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]. Length = 209 Score = 29.8 bits (67), Expect = 1.1 Identities = 10/47 (21%), Positives = 25/47 (53%) Query: 22 PVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDP 68 P ++ +++ LL PG +L+ G+G + ++ V++++R Sbjct: 58 PHMVARMLQLLELKPGDRVLEIGTGSGYQAAVLARLVGRVVSIERIE 104 >gnl|CDD|109456 pfam00398, RrnaAD, Ribosomal RNA adenine dimethylase. Length = 258 Score = 29.6 bits (67), Expect = 1.4 Identities = 9/47 (19%), Positives = 20/47 (42%) Query: 22 PVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDP 68 ++ +++ N +L+ G G + K V+A++ DP Sbjct: 16 KKVINRIVDKANLQESDTVLEIGPGKGALTEELAKRAKQVVAIEIDP 62 >gnl|CDD|30380 COG0030, KsgA, Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]. Length = 259 Score = 29.4 bits (66), Expect = 1.5 Identities = 12/63 (19%), Positives = 26/63 (41%) Query: 20 HVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMR 79 +++K++ N +PG +L+ G G + + + V A++ D +E Sbjct: 14 IDKNVIDKIVEAANISPGDNVLEIGPGLGALTEPLLERAARVTAIEIDRRLAEVLKERFA 73 Query: 80 DYK 82 Y Sbjct: 74 PYD 76 >gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes, or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 330 Score = 28.4 bits (64), Expect = 2.7 Identities = 19/87 (21%), Positives = 31/87 (35%), Gaps = 26/87 (29%) Query: 33 NPAPGKVILDATFGAGG-------YSRSFCKMGSNVIALDRDP----FAVSCGQETMRDY 81 P PG+ + A G GG Y+R MG +A+ R P A G + Sbjct: 159 GPRPGERV--AVLGIGGLGHLAVQYAR---AMGFETVAITRSPDKRELARKLGAD----- 208 Query: 82 KEQFSLFQATFSQLQDYVPDKGVDGVV 108 + ++L + G D ++ Sbjct: 209 -----EVVDSGAELDEQAAAGGADVIL 230 >gnl|CDD|31243 COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair]. Length = 347 Score = 28.4 bits (63), Expect = 2.9 Identities = 19/80 (23%), Positives = 28/80 (35%) Query: 31 LLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQA 90 L G+++LD G GG MG+ VI D D V + + Y + Sbjct: 192 LARVKRGELVLDPFCGTGGILIEAGLMGARVIGSDIDERMVRGAKINLEYYGIEDYPVLK 251 Query: 91 TFSQLQDYVPDKGVDGVVFD 110 + D VD + D Sbjct: 252 VLDATNLPLRDNSVDAIATD 271 >gnl|CDD|30493 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]. Length = 355 Score = 28.1 bits (62), Expect = 3.9 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Query: 28 VIALLNPAPGKVILDATFGAGGYSRSFCKMGSN----VIALDRDP 68 +L+P PG+ +LD GG + ++ N V+A+D P Sbjct: 148 PALVLDPKPGERVLDLCAAPGGKTTHLAELMENEGAIVVAVDVSP 192 >gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 324 Score = 28.1 bits (63), Expect = 3.9 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 9 MSSAIHHTIGDHVPVLLEKVIALLNPAPGKVIL 41 M +A+H GD VL + P G+V++ Sbjct: 1 MRAAVHTQFGDPADVLEIGEVPKPTPGAGEVLV 33 >gnl|CDD|35481 KOG0260, KOG0260, KOG0260, RNA polymerase II, large subunit [Transcription]. Length = 1605 Score = 27.6 bits (61), Expect = 4.6 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 299 DVAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTLSQ 338 D+ +++R+ L+ G + VER + D V R P+L + Sbjct: 406 DLRYHKRAGDIHLQPGYK-VERHLMDGDVVLFNRQPSLHK 444 >gnl|CDD|32445 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]. Length = 300 Score = 27.2 bits (60), Expect = 6.8 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 9/81 (11%) Query: 36 PGKVILDATFGAGGYSRSFCKMG-SNVIALDRDPFAVSCGQETMRDYKEQFSLFQ-ATFS 93 GK +LD G+G + + K+G V+ +D DP AV +E L Sbjct: 162 KGKTVLDVGCGSGILAIAAAKLGAKKVVGVDIDPQAV-------EAARENARLNGVELLV 214 Query: 94 QLQDYVPDKGVDGVVFDLGVS 114 Q + ++ + + FD+ V+ Sbjct: 215 QAKGFLLLEVPENGPFDVIVA 235 >gnl|CDD|132929 cd07018, S49_SppA_67K_type, Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad. Signal peptide peptidase A (SppA; Peptidase S49; Protease IV) 67K type: SppA is found in all three domains of life and is involved in the cleavage of signal peptides after their removal from the precursor proteins by signal peptidases. Members in this subfamily contain an amino-terminal domain in addition to the carboxyl-terminal protease domain that is conserved in all the S49 family members (sometimes referred to as 67K type), similar to E. coli and Arabidopsis thaliana SppA peptidases. Unlike the eukaryotic functional homologs that are proposed to be aspartic proteases, site-directed mutagenesis and sequence analysis have shown that members in this subfamily, mostly bacterial, are serine proteases. The predicted active site serine for members in this family occurs in a transmembrane domain. Mutagenesis studies also suggest that the catalytic center comprises a Ser-Lys dyad (both residues absolutely conserved within bacteria, chloroplast and mitochondrial signal peptidase family members) and not the usual Ser-His-Asp catalytic triad found in the majority of serine proteases. Interestingly, the single membrane spanning E. coli SppA carries out catalysis using a Ser-Lys dyad with the serine located in the conserved carboxy-terminal protease domain and the lysine in the non-conserved amino-terminal domain. Length = 222 Score = 27.1 bits (61), Expect = 7.6 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Query: 218 RIFVNNEIEELA-QGLRSAEKALKAGGLLI--VVSFHSLEDRL 257 R + +E L G SAE+AL+AG L+ + LE RL Sbjct: 180 RGLSPDALEALIDLGGDSAEEALEAG--LVDGLAYRDELEARL 220 >gnl|CDD|147132 pfam04821, TIMELESS, Timeless protein. The timeless gene in Drosophila melanogaster and its homologues in a number of other insects and mammals (including human) are involved in circadian rhythm control. This family includes a related proteins from a number of fungal species. Length = 266 Score = 26.8 bits (60), Expect = 8.0 Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 7/55 (12%) Query: 76 ETMRDYKEQFSLFQATFSQLQDY-------VPDKGVDGVVFDLGVSSMQIDCGDR 123 E + + + + +LQ+ D V V L + S+ + DR Sbjct: 75 ELLVGKEPKTVNGRRHIPELQEALQGYKEAFLDAKVLKAVVRLLLPSLAVPWEDR 129 >gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like. Lactaldehyde dehydrogenase from Escherichia coli (AldA, LactADH, EC=1.2.1.22), an NAD(+)-dependent enzyme involved in the metabolism of L-fucose and L-rhamnose, and other similar sequences are present in this CD. Length = 468 Score = 26.8 bits (60), Expect = 9.0 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Query: 191 LSSLIQKTVYFSKN-NRIHPATRSFQALRIFVNNEIEELAQG 231 L+S I +++N N AT + ++N E E QG Sbjct: 402 LTSYI-----YTENLNTAMRATNELEFGETYINRENFEAMQG 438 >gnl|CDD|36484 KOG1270, KOG1270, KOG1270, Methyltransferases [Coenzyme transport and metabolism]. Length = 282 Score = 26.9 bits (59), Expect = 9.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Query: 34 PAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQE 76 P G ILD G G S ++G+ V +D V E Sbjct: 87 PLLGMKILDVGCGGGLLSEPLARLGAQVTGIDASDDMVEVANE 129 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.134 0.377 Gapped Lambda K H 0.267 0.0759 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,864,870 Number of extensions: 195835 Number of successful extensions: 559 Number of sequences better than 10.0: 1 Number of HSP's gapped: 547 Number of HSP's successfully gapped: 25 Length of query: 341 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 247 Effective length of database: 4,232,491 Effective search space: 1045425277 Effective search space used: 1045425277 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.1 bits)