BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764512|ref|YP_003065529.2| preprotein tranlocase protein
[Candidatus Liberibacter asiaticus str. psy62]
         (108 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|83593100|ref|YP_426852.1| protein translocase subunit yajC [Rhodospirillum rubrum ATCC 11170]
 gi|83576014|gb|ABC22565.1| protein translocase subunit yajC [Rhodospirillum rubrum ATCC 11170]
          Length = 143

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 72/108 (66%), Gaps = 3/108 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YAQS   A   A   LE      ++ V++YFLLIRPQ+++++    ML  +RRGD
Sbjct: 9   LISPAYAQS---APGGALGGLEAFLPLILIFVIFYFLLIRPQQRRMKEHKAMLSAVRRGD 65

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +VT  G++G VV+VI++ EL +EIAENV+VRV+R  +  V SK+EPV
Sbjct: 66  KVVTNGGLIGTVVKVINEQELSLEIAENVKVRVMRDMIGNVLSKTEPV 113


>gi|207721608|ref|YP_002252047.1| preprotein translocase subunit yajc [Ralstonia solanacearum MolK2]
 gi|207744282|ref|YP_002260674.1| preprotein translocase subunit yajc [Ralstonia solanacearum
           IPO1609]
 gi|206586769|emb|CAQ17354.1| preprotein translocase subunit yajc [Ralstonia solanacearum MolK2]
 gi|206595687|emb|CAQ62614.1| preprotein translocase subunit yajc [Ralstonia solanacearum
           IPO1609]
          Length = 111

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YAQ+   A   A + L       ++ VV +F++IRPQ ++ +    ML  L +GD
Sbjct: 3   LISDAYAQTAGTAPGGAGNGLMSFLPIILMFVVLWFIMIRPQMKRQKETKTMLEALAKGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT+ GI+GKV +V  D  + VE+A N  + V ++ V+ V  K  
Sbjct: 63  EVVTSGGILGKVTKVA-DQYVTVEVAPNTELTVQKNAVTTVLPKGT 107


>gi|300703081|ref|YP_003744683.1| protein translocase auxillary subunit [Ralstonia solanacearum
           CFBP2957]
 gi|299070744|emb|CBJ42039.1| protein translocase auxillary subunit [Ralstonia solanacearum
           CFBP2957]
          Length = 111

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YAQ+   A   A + L       ++ VV +F++IRPQ ++ +    ML  L +GD
Sbjct: 3   LISDAYAQTAGTAPGGAGNGLMSFLPIILMFVVLWFIMIRPQMKRQKETKAMLEALAKGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT+ GI+GKV +V  D  + VE+A N  + V ++ V+ V  K  
Sbjct: 63  EVVTSGGILGKVTKVA-DQYVAVEVAPNTELTVQKNAVTTVLPKGT 107


>gi|288958293|ref|YP_003448634.1| immunogenic membrane protein [Azospirillum sp. B510]
 gi|288910601|dbj|BAI72090.1| immunogenic membrane protein [Azospirillum sp. B510]
          Length = 141

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF +T YAQ+ APA       L       ++ VV+YFLLIRPQ+++++    ML  +RRG
Sbjct: 1   MFVSTAYAQTAAPA-GGGGDMLVQFAPLILIFVVFYFLLIRPQQKKMKEHKAMLSAIRRG 59

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D +VT  GI+G V +V  D E+ VEIAENVRVR +RS V+ V +K+EP
Sbjct: 60  DRVVTGGGIIGIVTKVGTDDEITVEIAENVRVRCLRSTVNLVLAKTEP 107


>gi|255764512|ref|YP_003065529.2| preprotein tranlocase protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547863|gb|ACT57589.2| preprotein tranlocase protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 108

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 108/108 (100%), Positives = 108/108 (100%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD
Sbjct: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV
Sbjct: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108


>gi|315122581|ref|YP_004063070.1| preprotein tranlocase protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495983|gb|ADR52582.1| preprotein tranlocase protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 112

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 82/108 (75%), Positives = 95/108 (87%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +FT  YAQSDAP+I S TSPLEMA LFFVLAVVWYFLLIRPQRQQ ++R+EML NLRRGD
Sbjct: 2   LFTKAYAQSDAPSINSVTSPLEMAFLFFVLAVVWYFLLIRPQRQQFKKRSEMLHNLRRGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           SIVTAAGI+GK+ +VIDD E+EVEI+E VRV V+RS++SEV SK EPV
Sbjct: 62  SIVTAAGIIGKITKVIDDSEVEVEISEGVRVHVLRSYISEVLSKPEPV 109


>gi|312113471|ref|YP_004011067.1| preprotein translocase, YajC subunit [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218600|gb|ADP69968.1| preprotein translocase, YajC subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 129

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 70/108 (64%), Gaps = 3/108 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +  YAQ+       A     M     ++ V++Y L+ RPQ+++++    ML  ++RGD
Sbjct: 1   MISPAYAQA---PGAGAGDIFGMLFPLILVFVIFYLLVFRPQQKRMKEHQAMLDAVKRGD 57

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           ++VTA GI+GKV R+  D EL++EIA+ V+VRV++S +++V+ K EPV
Sbjct: 58  TVVTAGGIIGKVTRIGADGELKIEIADGVQVRVLKSTITDVRGKGEPV 105


>gi|118589129|ref|ZP_01546536.1| YajC [Stappia aggregata IAM 12614]
 gi|118438458|gb|EAV45092.1| YajC [Stappia aggregata IAM 12614]
          Length = 111

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ+  PA  S    L     F  +  + YFL+IRPQRQ++++  EM+ NLRRGD+
Sbjct: 3   ITPAYAQAAGPAGASG--FLIQILPFVAIFAIMYFLIIRPQRQRMKKHQEMVSNLRRGDT 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +VT  G++GKV +V+DD E++VE++E V+VR+VRS V EV+SK+EP
Sbjct: 61  VVTTGGLIGKVSKVVDDGEVQVELSEGVKVRLVRSMVQEVRSKTEP 106


>gi|209964362|ref|YP_002297277.1| preprotein translocase subunit YajC, putative [Rhodospirillum
           centenum SW]
 gi|209957828|gb|ACI98464.1| preprotein translocase subunit YajC, putative [Rhodospirillum
           centenum SW]
          Length = 125

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +T +AQ          + L       ++ VV+YFLLIRPQ+++++    ML  LRRGD 
Sbjct: 3   ISTAFAQGAGAPAEP--NALVSLLPLILIFVVFYFLLIRPQQKKMKEHKAMLEALRRGDR 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +VT  GIVG VV+V  D EL VEIAE VRVRV+R  VS V +K+EP
Sbjct: 61  VVTGGGIVGTVVKVGPDDELTVEIAEGVRVRVIRGTVSAVLAKTEP 106


>gi|150396392|ref|YP_001326859.1| preprotein translocase subunit YajC [Sinorhizobium medicae WSM419]
 gi|150027907|gb|ABR60024.1| preprotein translocase, YajC subunit [Sinorhizobium medicae WSM419]
          Length = 110

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +AQ+ AP    A   L     F ++ VV YFL+IRPQR Q++RR E+L+N+RRGD 
Sbjct: 3   ITEAFAQTAAPGGGGA-DILMSILPFLLIFVVMYFLIIRPQRAQMKRREELLKNIRRGDQ 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +VT  GIVGKV +V+DD ELEVEIAE  +VRVVRS VSEV+ K EPV
Sbjct: 62  VVTGGGIVGKVTKVVDDTELEVEIAEGTKVRVVRSGVSEVRVKGEPV 108


>gi|87121909|ref|ZP_01077794.1| hypothetical protein MED121_20496 [Marinomonas sp. MED121]
 gi|86162707|gb|EAQ63987.1| hypothetical protein MED121_20496 [Marinomonas sp. MED121]
          Length = 109

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M + + A     A   A + +    L     +++YFL+ RPQ ++ +    ++ +L +G 
Sbjct: 1   MISLISAAHAEGAGAPADAGILNLVLLVGFVLIFYFLMWRPQAKRQKEHKNLMASLAKGS 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T  G++GKV +V +D  + +E+AE V +   ++ V+ V  K  
Sbjct: 61  EVLTNGGMLGKVTKV-NDNYVVLEVAEGVELNFQKASVAAVLPKGT 105


>gi|209549096|ref|YP_002281013.1| preprotein translocase, YajC subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534852|gb|ACI54787.1| preprotein translocase, YajC subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 115

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 61/108 (56%), Positives = 75/108 (69%), Gaps = 1/108 (0%)

Query: 2   FTTVYAQSDAPAITS-ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
            T  +AQS     T    S  EM  LF  L VVWYFLLIRPQR Q ++R E L+ +RRGD
Sbjct: 3   ITPAFAQSATDTATGFGGSGFEMIILFVPLMVVWYFLLIRPQRAQAKKREETLKAIRRGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +VT  G+VGKV +VIDD E+EVEIA+ VRVR+VRS +S+V+ K EPV
Sbjct: 63  QVVTGGGLVGKVTKVIDDKEVEVEIADGVRVRIVRSGISDVRVKGEPV 110


>gi|90424274|ref|YP_532644.1| preprotein translocase, YajC subunit [Rhodopseudomonas palustris
           BisB18]
 gi|90106288|gb|ABD88325.1| protein translocase subunit yajC [Rhodopseudomonas palustris
           BisB18]
          Length = 144

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 76/108 (70%), Gaps = 1/108 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  +AQ+   A    +S L     F ++ V+ YFL++RPQ+++++  AE+++N+RRGD
Sbjct: 2   LITPAFAQAAGSAGD-TSSMLMSLLPFALIFVIMYFLILRPQQKKVKEHAELVKNVRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +I+T+ G+VGKV +V+DD  LE E+A+ VRVR +R  ++ V++K EP+
Sbjct: 61  TIITSGGLVGKVTKVVDDDSLEFEVADGVRVRQMRQMITGVRAKGEPL 108


>gi|222085793|ref|YP_002544323.1| preprotein tranlocase protein [Agrobacterium radiobacter K84]
 gi|221723241|gb|ACM26397.1| preprotein tranlocase protein [Agrobacterium radiobacter K84]
          Length = 116

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 3/111 (2%)

Query: 1   MF-TTVYAQSDAPAITS--ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           MF T  YAQS   +  S    S  EM  LF  L VVWYFLLIRPQR Q ++R E+L+N+R
Sbjct: 1   MFVTNAYAQSATDSAASVFGGSGFEMIILFVPLMVVWYFLLIRPQRAQAKKRDEILKNIR 60

Query: 58  RGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           RGD +VT  GIVGKV +V+DD ELEVEIAE V++RVVRS +SEV+ K EPV
Sbjct: 61  RGDQVVTGGGIVGKVTKVVDDKELEVEIAEGVKIRVVRSAISEVRVKGEPV 111


>gi|15965291|ref|NP_385644.1| YAJC protein [Sinorhizobium meliloti 1021]
 gi|307307881|ref|ZP_07587606.1| preprotein translocase, YajC subunit [Sinorhizobium meliloti
           BL225C]
 gi|307317055|ref|ZP_07596496.1| preprotein translocase, YajC subunit [Sinorhizobium meliloti AK83]
 gi|15074471|emb|CAC46117.1| Probable YajC protein [Sinorhizobium meliloti 1021]
 gi|306897143|gb|EFN27888.1| preprotein translocase, YajC subunit [Sinorhizobium meliloti AK83]
 gi|306901497|gb|EFN32100.1| preprotein translocase, YajC subunit [Sinorhizobium meliloti
           BL225C]
          Length = 110

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 61/107 (57%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +AQ+ AP    A   L     F ++ VV YFL+IRPQR Q++RR E+L+N+RRGD 
Sbjct: 3   ITEAFAQTAAPGGGGA-DILMSILPFLLIFVVMYFLIIRPQRAQMKRREELLKNIRRGDQ 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +VT  GIVGKV +V+DD ELEVEIAE ++VRVVRS VSEV+ K EPV
Sbjct: 62  VVTGGGIVGKVTKVVDDTELEVEIAEGIKVRVVRSGVSEVRVKGEPV 108


>gi|218512650|ref|ZP_03509490.1| putative Sec translocase associated protein [Rhizobium etli 8C-3]
 gi|327189122|gb|EGE56307.1| putative Sec translocase associated protein [Rhizobium etli
           CNPAF512]
          Length = 115

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 75/108 (69%), Gaps = 1/108 (0%)

Query: 2   FTTVYAQSDAPAITS-ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
            T  +AQS     T    S  EM  LF  L VVWYFLLIRPQR Q ++R E L+ +RRGD
Sbjct: 3   ITPAFAQSATDTATGFGGSGFEMIILFVPLMVVWYFLLIRPQRAQAKKREETLKAIRRGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +VT  G+VGKV +V+DD E+EVEIAE VRVR+VRS +SEV+ K EPV
Sbjct: 63  QVVTGGGLVGKVTKVVDDKEVEVEIAEGVRVRIVRSGISEVRVKGEPV 110


>gi|119476763|ref|ZP_01617073.1| Preprotein translocase subunit, YajC [marine gamma proteobacterium
           HTCC2143]
 gi|119450019|gb|EAW31255.1| Preprotein translocase subunit, YajC [marine gamma proteobacterium
           HTCC2143]
          Length = 109

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++ YAQ        A   +    L   L V++YF+ IRPQR++ +   E++ NL +GD 
Sbjct: 4   ISSAYAQEAGQNPPEAG--MMQLALMVGLFVMFYFIAIRPQRKRQKEHTELVSNLGKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT +GI+GK+ ++ DD  L +++A++V ++  +  +  V  K  
Sbjct: 62  VVTNSGILGKITQL-DDNYLTLQVADSVELKFQKGSIHAVLPKGT 105


>gi|6970056|gb|AAF34181.1|AF217543_2 putative membrane protein [Sinorhizobium meliloti]
          Length = 110

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +AQ+ AP    A   L     F ++ V  YFL+IRPQR Q++RR E+L+N+RRGD 
Sbjct: 3   ITEAFAQTAAPGGGGA-DILMSILPFLLIFVEMYFLIIRPQRAQMKRREELLKNIRRGDQ 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +VT  GIVGKV +V+DD ELEVEIAE ++VRVVRS VSEV+ K EPV
Sbjct: 62  VVTGGGIVGKVTKVVDDTELEVEIAEGIKVRVVRSGVSEVRVKGEPV 108


>gi|86357459|ref|YP_469351.1| preprotein tranlocase protein [Rhizobium etli CFN 42]
 gi|86281561|gb|ABC90624.1| preprotein tranlocase protein [Rhizobium etli CFN 42]
          Length = 115

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 1/108 (0%)

Query: 2   FTTVYAQSDAPAITS-ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
            TT +AQS     T    S  EM  LF  L VVWYFLLIRPQR Q ++R E L+++RRGD
Sbjct: 3   ITTAFAQSATDTATGFGGSGFEMIILFVPLMVVWYFLLIRPQRAQAKKREETLKSIRRGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +VT  G+VGKV +V+DD E+EVEIAE VRVR+VRS +SEV+ K EP+
Sbjct: 63  QVVTGGGLVGKVTKVVDDKEVEVEIAEGVRVRIVRSGISEVRVKGEPI 110


>gi|92117343|ref|YP_577072.1| preprotein translocase, YajC subunit [Nitrobacter hamburgensis X14]
 gi|91800237|gb|ABE62612.1| protein translocase subunit yajC [Nitrobacter hamburgensis X14]
          Length = 133

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 70/106 (66%), Gaps = 2/106 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +AQ+     T   + L     F ++ V+ YFL+IRPQ+++ +   E+++N+RRGD 
Sbjct: 3   ITPAFAQAAGAGDT--NNLLMSLLPFALIFVIMYFLIIRPQQKKAKEHNELVKNIRRGDI 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           ++T  G+VGKV +V+DD ++E E+A+ VRVR +R  +S V++K EP
Sbjct: 61  VITTGGLVGKVTKVVDDDQIEFEVADGVRVRQMRQMISIVRAKGEP 106


>gi|62257781|gb|AAX77738.1| unknown protein [synthetic construct]
          Length = 153

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 63/103 (61%), Gaps = 4/103 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           +T +AQ    A     SPL    +  V   +++FLLIRPQ+++ +   +ML  L +GD +
Sbjct: 42  STSFAQGAEQAA---GSPLSSILMLVVFFAIFWFLLIRPQQKKNKELRKMLSELSKGDEV 98

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           VT  G+VGK+ ++ D+  +++E+A+NV V++ R+ V+ +  K 
Sbjct: 99  VTNGGMVGKIAKI-DETFVDLEVADNVTVKIQRNAVANILPKG 140


>gi|116251814|ref|YP_767652.1| Sec translocase associated protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256462|emb|CAK07546.1| putative Sec translocase associated protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 115

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 60/108 (55%), Positives = 75/108 (69%), Gaps = 1/108 (0%)

Query: 2   FTTVYAQSDAPAITS-ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
            T  +AQS     T    S  EM  LF  L VVWYFLLIRPQR Q ++R E L+ +RRGD
Sbjct: 3   ITPAFAQSATDTATGFGGSGFEMIILFVPLMVVWYFLLIRPQRAQAKKREETLKAIRRGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +VT  G+VGKV +VID+ E+EVEIA+ VRVR+VRS +SE++ K EPV
Sbjct: 63  QVVTGGGLVGKVTKVIDEKEVEVEIADGVRVRIVRSGISEIRVKGEPV 110


>gi|209885376|ref|YP_002289233.1| preprotein translocase, YajC subunit [Oligotropha carboxidovorans
           OM5]
 gi|209873572|gb|ACI93368.1| preprotein translocase, YajC subunit [Oligotropha carboxidovorans
           OM5]
          Length = 113

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ+ A       S L     F ++ V+ YFL++RPQ+++ +    +++N+RRGD
Sbjct: 2   LITPAYAQAAA--GGDTNSMLMSLLPFVMIFVIMYFLILRPQQRKAKEHTNLVKNIRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           ++VT  G+VGKV +V+DD ++E+E+++ VR+R +R  ++ V+SK EP
Sbjct: 60  TVVTNGGLVGKVTKVVDDEQIEMEVSDGVRIRQMRQMIAGVRSKGEP 106


>gi|56697181|ref|YP_167545.1| preprotein translocase, YajC subunit [Ruegeria pomeroyi DSS-3]
 gi|56678918|gb|AAV95584.1| preprotein translocase, YajC subunit [Ruegeria pomeroyi DSS-3]
          Length = 121

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 61/90 (67%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + Y LLIRPQ+++++    M+  LRRGD ++T  G++GKV +V +
Sbjct: 30  GGAIAQFLPLILIFAIMYLLLIRPQQKKVKEHQAMVSALRRGDQVITQGGLIGKVAKVKE 89

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVEIAE V+VRVV+S +++V +K+EP
Sbjct: 90  DGEIEVEIAEGVKVRVVKSTIAQVLNKTEP 119


>gi|217978986|ref|YP_002363133.1| preprotein translocase, YajC subunit [Methylocella silvestris BL2]
 gi|217504362|gb|ACK51771.1| preprotein translocase, YajC subunit [Methylocella silvestris BL2]
          Length = 114

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 78/108 (72%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MFT  +AQ+   A   AT  +     F ++  + YFL++RPQ+++ +  A++++NLRRGD
Sbjct: 1   MFTPAFAQAAGGAGGGATDLIVQLIPFALILAIMYFLIMRPQQKRAREHADLIKNLRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           S+VT+ G++GKV +VIDD E+E+EIA NVRVRV R  V++V+SK EPV
Sbjct: 61  SVVTSGGLIGKVTKVIDDAEVELEIAPNVRVRVARGLVTDVRSKGEPV 108


>gi|254282453|ref|ZP_04957421.1| preprotein translocase, YajC subunit [gamma proteobacterium
           NOR51-B]
 gi|219678656|gb|EED35005.1| preprotein translocase, YajC subunit [gamma proteobacterium
           NOR51-B]
          Length = 111

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
               YAQ+           L   G   VL  ++YF+ IRPQR++ +   EM+  L++GD 
Sbjct: 3   IQNAYAQAAGGQPAGGE--LFQIGFLVVLFGLFYFIAIRPQRKRQKEHQEMVDALKKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T++G++GK+  + DD  + + +  NV ++  R+ ++ V  K  
Sbjct: 61  VITSSGMLGKITGI-DDNYIVLSVTNNVELKFQRAHINAVLPKGT 104


>gi|298291859|ref|YP_003693798.1| preprotein translocase, YajC subunit [Starkeya novella DSM 506]
 gi|296928370|gb|ADH89179.1| preprotein translocase, YajC subunit [Starkeya novella DSM 506]
          Length = 113

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +AQ    A    T  L     F ++ V+ YFL++RPQ+++++   EM++++RRGD+
Sbjct: 3   ITPAFAQGAPTA--GGTDMLMSLLPFVLIFVIMYFLILRPQQKKVKAHQEMVKSVRRGDT 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +VT+ G++GKV RV+DD E+E+++AE V++R +R  +SEV++K EP
Sbjct: 61  VVTSGGLIGKVARVVDDNEIELQLAEGVKIRQLRGMISEVRAKGEP 106


>gi|146340965|ref|YP_001206013.1| preprotein translocase YajC [Bradyrhizobium sp. ORS278]
 gi|146193771|emb|CAL77788.1| preprotein translocase (YajC) [Bradyrhizobium sp. ORS278]
          Length = 122

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 74/107 (69%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ+     T   S L     F ++ V+ YFL++RPQ+++++  A++++N+RRGD
Sbjct: 2   LITPAYAQAAGAGDT--NSMLMSLLPFALIFVIMYFLILRPQQKKVKEHADLVKNVRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +IVT  G+VGKV +V+DD ++E EIA+ VRVR +R  ++ V++K EP
Sbjct: 60  TIVTQGGLVGKVTKVVDDDQVEFEIADGVRVRQMRQMITGVRTKGEP 106


>gi|254469166|ref|ZP_05082571.1| preprotein translocase, YajC subunit [Pseudovibrio sp. JE062]
 gi|211961001|gb|EEA96196.1| preprotein translocase, YajC subunit [Pseudovibrio sp. JE062]
          Length = 109

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 74/108 (68%), Gaps = 4/108 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ    A   A   +     F ++ V+ +FL+IRPQRQ+++   EM+ NLRRGD
Sbjct: 2   LITPAYAQ----AAGGAPDVIMSIVPFVLIFVIMWFLIIRPQRQRMKSHQEMVNNLRRGD 57

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           ++VT+ G++GKV +V+D+ EL+V+IAE  RVR+ R+ + EV+SK EPV
Sbjct: 58  TVVTSGGLIGKVAKVVDEAELQVDIAEGTRVRIARAMIQEVRSKGEPV 105


>gi|75675962|ref|YP_318383.1| preprotein translocase subunit, YajC [Nitrobacter winogradskyi
           Nb-255]
 gi|74420832|gb|ABA05031.1| protein translocase subunit yajC [Nitrobacter winogradskyi Nb-255]
          Length = 133

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +AQ+       A S L     F ++ ++ YFL+IRPQ+++ +  AE+++N+RRGD+
Sbjct: 3   ITPAFAQAAG--SGDANSLLMSLLPFALIFIIMYFLIIRPQQKKAKEHAELVKNIRRGDT 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           ++T++G+VGKV +V+DD ++E EIA+ VRVR +R  +S V++K EP
Sbjct: 61  VITSSGLVGKVTKVVDDEQIEFEIADGVRVRQMRQMISIVRAKGEP 106


>gi|85716185|ref|ZP_01047160.1| Preprotein translocase subunit, YajC [Nitrobacter sp. Nb-311A]
 gi|85697018|gb|EAQ34901.1| Preprotein translocase subunit, YajC [Nitrobacter sp. Nb-311A]
          Length = 128

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 75/107 (70%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  +AQ+   + T   + L     F ++ ++ YFL+IRPQ+++++   E+++N+RRGD
Sbjct: 2   LITPAFAQAAGASDT--NNLLMSLLPFALIFIIMYFLIIRPQQKKVKEHNELVKNIRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +++T +G+VGKV +V+D+ ++E+EIA+ VRVR +R  +S V+ K EP
Sbjct: 60  TVITTSGLVGKVTKVVDEDQIELEIADGVRVRQMRQMISIVRVKGEP 106


>gi|328543821|ref|YP_004303930.1| Preprotein translocase, YajC subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326413565|gb|ADZ70628.1| Preprotein translocase, YajC subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 110

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 3/107 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ+   A       L     F ++  + YFL+IRPQRQ++++  EM+ NLRRGD+
Sbjct: 3   ITPAYAQAGGVA---GPDFLMSLLPFVLIFAIMYFLIIRPQRQRMKQHQEMVTNLRRGDT 59

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +VT  G++ KV +V+DD E++VE+AE V+ R+VR  + EV+SK EPV
Sbjct: 60  VVTTGGLIVKVTKVVDDSEVQVELAEGVKARMVRGMIQEVRSKGEPV 106


>gi|27379847|ref|NP_771376.1| preprotein tranlocase protein [Bradyrhizobium japonicum USDA 110]
 gi|27353000|dbj|BAC50001.1| preprotein tranlocase protein [Bradyrhizobium japonicum USDA 110]
          Length = 125

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 75/107 (70%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ+     T   S L     F ++ V+ YFL++RPQ+++++  A++++N+RRGD
Sbjct: 2   LITPAYAQAAGAGDT--NSMLMSLLPFALIFVIMYFLILRPQQKKVRDHADLVKNIRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           ++VT+ G+VGKV +V+DD ++E EI++ VRVR +R  +S V++K EP
Sbjct: 60  TVVTSGGLVGKVTKVVDDDQIEFEISDGVRVRQMRQMISGVRAKGEP 106


>gi|148255767|ref|YP_001240352.1| protein translocase subunit yajC [Bradyrhizobium sp. BTAi1]
 gi|146407940|gb|ABQ36446.1| protein translocase subunit yajC [Bradyrhizobium sp. BTAi1]
          Length = 118

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 74/107 (69%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ+     T   S L     F ++ V+ YFL++RPQ+++++  A++++N+RRGD
Sbjct: 2   LITPAYAQAAGAGDT--NSMLMSLLPFALIFVIMYFLILRPQQKKVKEHADLVKNVRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +IVT  G+VGKV +V+DD ++E EIA+ VRVR +R  ++ V++K EP
Sbjct: 60  TIVTQGGLVGKVTKVVDDDQVEFEIADGVRVRQMRQMITGVRTKGEP 106


>gi|325292959|ref|YP_004278823.1| preprotein tranlocase protein [Agrobacterium sp. H13-3]
 gi|325060812|gb|ADY64503.1| preprotein tranlocase protein [Agrobacterium sp. H13-3]
          Length = 115

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 74/107 (69%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ  A   ++  S LEM  LF  L VVWYF LIRPQR Q+++R E L N+RRGD 
Sbjct: 3   ISQAFAQDTAGGASAFGSGLEMLFLFAPLMVVWYFFLIRPQRAQMKKRQETLTNIRRGDQ 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V   GIVGKV +VIDD ELEVEIAE V++R  R++++EV+ K E V
Sbjct: 63  VVLGGGIVGKVTKVIDDNELEVEIAEGVKIRAARAYIAEVRVKGEVV 109


>gi|239831769|ref|ZP_04680098.1| preprotein translocase, YajC subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239824036|gb|EEQ95604.1| preprotein translocase, YajC subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 113

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 56/109 (51%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+   A       L     F ++ V+ YFL+IRPQR Q+++R EML  +RRG
Sbjct: 1   MFVTPAFAQASGGAAGP--DMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLSQVRRG 58

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  GIVGKV +V+DD ELEVEIAE VR+RV+RS + +V+ K EPV
Sbjct: 59  DTVVTGGGIVGKVQKVVDDNELEVEIAEGVRIRVMRSTLMDVRVKGEPV 107


>gi|89094743|ref|ZP_01167678.1| preprotein translocase, YajC subunit [Oceanospirillum sp. MED92]
 gi|89080997|gb|EAR60234.1| preprotein translocase, YajC subunit [Oceanospirillum sp. MED92]
          Length = 110

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA+  A A     S +          +++YF + RPQ ++ +   E+L  L +GD 
Sbjct: 5   ISPAYAEGAAGA--PMDSGMFNILFLVGFGLIFYFFMWRPQAKRAKEHKELLGGLTKGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++TA GI+GKVV + +D  + +E++E   +   ++ VS    K  
Sbjct: 63  VITAGGILGKVVNLNED-YVVLEVSEGTELTFQKTHVSAALPKGT 106


>gi|163759441|ref|ZP_02166526.1| probable yajc protein [Hoeflea phototrophica DFL-43]
 gi|162283038|gb|EDQ33324.1| probable yajc protein [Hoeflea phototrophica DFL-43]
          Length = 107

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 78/109 (71%), Gaps = 5/109 (4%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  YAQ+           L     F ++ V+ YFL+IRPQR Q+++R EML+N+RRG
Sbjct: 1   MFVTPAYAQTA----GGGGEILMSILPFVLIFVIMYFLIIRPQRMQMKKREEMLKNVRRG 56

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D +VT  G++GKV +VIDD ELEVEIA+ V+VR++RS +++V++KSEPV
Sbjct: 57  DQVVTGGGVLGKVTKVIDDAELEVEIADGVKVRLMRSLIADVRAKSEPV 105


>gi|326794833|ref|YP_004312653.1| preprotein translocase, YajC subunit [Marinomonas mediterranea
           MMB-1]
 gi|326545597|gb|ADZ90817.1| preprotein translocase, YajC subunit [Marinomonas mediterranea
           MMB-1]
          Length = 108

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 58/106 (54%), Gaps = 5/106 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YA+  APA       +    L     +++YFL+ RPQ ++ +    ++ +L +G 
Sbjct: 4   LISPAYAEGGAPADAG----IFNIVLLVGFVIIFYFLMWRPQAKRAKEHRNLIASLAKGT 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT+ GI+GKV +V DD  + +E+++ V ++  ++ V+ V  K  
Sbjct: 60  EVVTSGGILGKVTKV-DDNYIVLEVSDEVEMKFQKASVTSVLPKGT 104


>gi|71908892|ref|YP_286479.1| preprotein translocase subunit YajC [Dechloromonas aromatica RCB]
 gi|71848513|gb|AAZ48009.1| protein translocase subunit yajC [Dechloromonas aromatica RCB]
          Length = 108

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +  +AQ+ A +       +       ++ VV +FL+IRPQ ++ +    +L  L +GD
Sbjct: 1   MISLAHAQTAAASSDPTGGLMG-LLPMILMFVVLWFLMIRPQMKKAKEHKALLGALAKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT  GIVGK+V+V +   + VEIAE   V V +  +  V  K  
Sbjct: 60  EVVTQGGIVGKIVKVGE-NYVTVEIAEGTEVVVQKPSIGLVLPKGT 104


>gi|186477274|ref|YP_001858744.1| preprotein translocase subunit YajC [Burkholderia phymatum STM815]
 gi|184193733|gb|ACC71698.1| preprotein translocase, YajC subunit [Burkholderia phymatum STM815]
          Length = 109

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ    A   A S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQ--GSAAGGAESSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVGKV +V +   + VEIAE   + V ++ V+ +  K  
Sbjct: 62  VVTNGGIVGKVTKVGEA-YVGVEIAEGTEITVQKASVTTILPKGT 105


>gi|83311614|ref|YP_421878.1| preprotein translocase subunit YajC [Magnetospirillum magneticum
           AMB-1]
 gi|82946455|dbj|BAE51319.1| Preprotein translocase subunit YajC [Magnetospirillum magneticum
           AMB-1]
          Length = 134

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/108 (47%), Positives = 74/108 (68%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF +      A A   +   LE      ++ VV+YFLLIRPQ++++++  EML  LRRGD
Sbjct: 2   MFVSPAYAQAAAAGGGSFGALEQFLPLILIFVVFYFLLIRPQQKKMKQHKEMLGQLRRGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            ++TA GI+G V ++I+D E+ VEIAE VRVRV+R+ ++EV SK+EPV
Sbjct: 62  RVLTAGGIIGTVNKLINDTEVSVEIAEGVRVRVLRTTITEVMSKTEPV 109


>gi|17987360|ref|NP_539994.1| hypothetical protein BMEI1077 [Brucella melitensis bv. 1 str. 16M]
 gi|237815321|ref|ZP_04594319.1| preprotein translocase, YajC subunit [Brucella abortus str. 2308 A]
 gi|306840383|ref|ZP_07473149.1| preprotein translocase, YajC subunit [Brucella sp. BO2]
 gi|17983045|gb|AAL52258.1| hypothetical exported protein [Brucella melitensis bv. 1 str. 16M]
 gi|237790158|gb|EEP64368.1| preprotein translocase, YajC subunit [Brucella abortus str. 2308 A]
 gi|306289647|gb|EFM60849.1| preprotein translocase, YajC subunit [Brucella sp. BO2]
          Length = 120

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/109 (48%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+    +      L     F ++ V+ YFL+IRPQR Q+++R EML ++RRG
Sbjct: 8   MFVTPAFAQASGSVVGP--DMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRG 65

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  GIVGKV++V+DD ELE+EIA+ VR+RVVR+ + +V+ K EPV
Sbjct: 66  DTVVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPV 114


>gi|152996659|ref|YP_001341494.1| preprotein translocase subunit YajC [Marinomonas sp. MWYL1]
 gi|150837583|gb|ABR71559.1| preprotein translocase, YajC subunit [Marinomonas sp. MWYL1]
          Length = 108

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 57/106 (53%), Gaps = 5/106 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YA+  APA       +    L     V++YFL+ RPQ ++ +    ++ +L +G 
Sbjct: 4   LISPAYAEGGAPADAG----IFNLVLLAGFVVIFYFLMWRPQAKRAKEHKNLIASLAKGT 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT  G++GKV +V DD  + +E++E + ++  +S V+ V  K  
Sbjct: 60  EVVTGGGVLGKVSKV-DDNYVVLEVSEGIEMKFQKSSVAAVLPKGT 104


>gi|289665551|ref|ZP_06487132.1| preprotein translocase subunit YajC [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289667765|ref|ZP_06488840.1| preprotein translocase subunit YajC [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 117

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSAT-SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           +     AQ+   A        L    L  +L  V YFL+IRPQ ++ +    +L  L RG
Sbjct: 7   LIPVAQAQATGAAPAPGPLGGLSTFALPVILIAVMYFLMIRPQMKRQKEHKSLLDKLARG 66

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D ++T+ G+ G +  +  D  + VE+A+NVR+RV +S V  V  K  
Sbjct: 67  DEVITSGGVAGVITDI-GDNFISVEVADNVRIRVQKSAVGHVLPKGT 112


>gi|238026273|ref|YP_002910504.1| preprotein translocase subunit YajC [Burkholderia glumae BGR1]
 gi|237875467|gb|ACR27800.1| Preprotein translocase, YajC subunit [Burkholderia glumae BGR1]
          Length = 108

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ    A  SA S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQ---GAGGSAESSLMSFLPLVLMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G+VGKV +V +   + VE++E   + V +S V+ +  K  
Sbjct: 61  VVTNGGLVGKVTKVGEA-YVGVEVSEGTEITVQKSAVTTILPKGT 104


>gi|225627379|ref|ZP_03785416.1| preprotein translocase, YajC subunit [Brucella ceti str. Cudo]
 gi|225617384|gb|EEH14429.1| preprotein translocase, YajC subunit [Brucella ceti str. Cudo]
          Length = 120

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 52/109 (47%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+    +      L     F ++ V+ YFL+IRPQR Q+++R +ML ++RRG
Sbjct: 8   MFVTPAFAQASGSVVGP--DMLMSILPFILIFVIMYFLIIRPQRTQMKKRQKMLNSVRRG 65

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  GIVGKV++V+DD ELE+EIA+ VR+RVVR+ + +V+ K EPV
Sbjct: 66  DTVVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPV 114


>gi|90021307|ref|YP_527134.1| protein translocase subunit yajC [Saccharophagus degradans 2-40]
 gi|89950907|gb|ABD80922.1| protein translocase subunit yajC [Saccharophagus degradans 2-40]
          Length = 109

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
                AQ++               L   L +  YF++IRPQR++ +   E+   L +GD 
Sbjct: 5   IQDAVAQTE---TAGQPGGWFQFVLLGGLFLFMYFVIIRPQRKRQKEHQELTSGLSKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT +G++GK+V V DD  + +E+++NV+++  +  V  V  K  
Sbjct: 62  VVTTSGMLGKIVEV-DDNYITLEVSDNVKLKFQKLAVHAVLPKGT 105


>gi|114707234|ref|ZP_01440132.1| probable yajc protein [Fulvimarina pelagi HTCC2506]
 gi|114537430|gb|EAU40556.1| probable yajc protein [Fulvimarina pelagi HTCC2506]
          Length = 113

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 76/108 (70%), Gaps = 2/108 (1%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+ APA    +  L     F  +  + YFL+IRPQRQQ+++R +ML N+RRG
Sbjct: 1   MFVTQAFAQTGAPA-GGGSELLLSILPFVAVFAIMYFLIIRPQRQQMKKRNQMLENIRRG 59

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D +VT  GI+GKV +V+D+ ELEV+I+E  RVR+VR+ +S+V+ K EP
Sbjct: 60  DQVVTGGGILGKVTKVLDNGELEVQISEQTRVRMVRAMISDVRVKGEP 107


>gi|23501776|ref|NP_697903.1| preprotein translocase subunit Yaj subunit [Brucella suis 1330]
 gi|62289835|ref|YP_221628.1| preprotein translocase, YajC subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82699760|ref|YP_414334.1| hypothetical protein BAB1_0909 [Brucella melitensis biovar Abortus
           2308]
 gi|161618850|ref|YP_001592737.1| preprotein translocase, YajC subunit [Brucella canis ATCC 23365]
 gi|163843161|ref|YP_001627565.1| preprotein translocase, YajC subunit [Brucella suis ATCC 23445]
 gi|189024076|ref|YP_001934844.1| YajC [Brucella abortus S19]
 gi|225852403|ref|YP_002732636.1| preprotein translocase subunit YajC [Brucella melitensis ATCC
           23457]
 gi|254689140|ref|ZP_05152394.1| hypothetical protein Babob68_02930 [Brucella abortus bv. 6 str.
           870]
 gi|254693624|ref|ZP_05155452.1| hypothetical protein Babob3T_02949 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697274|ref|ZP_05159102.1| hypothetical protein Babob28_06039 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701654|ref|ZP_05163482.1| hypothetical protein Bsuib55_12461 [Brucella suis bv. 5 str. 513]
 gi|254704198|ref|ZP_05166026.1| hypothetical protein Bsuib36_09774 [Brucella suis bv. 3 str. 686]
 gi|254730173|ref|ZP_05188751.1| hypothetical protein Babob42_02969 [Brucella abortus bv. 4 str.
           292]
 gi|256044564|ref|ZP_05447468.1| hypothetical protein Bmelb1R_08708 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060997|ref|ZP_05451154.1| hypothetical protein Bneo5_11632 [Brucella neotomae 5K33]
 gi|256113437|ref|ZP_05454278.1| hypothetical protein Bmelb3E_11887 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257390|ref|ZP_05462926.1| hypothetical protein Babob9C_08519 [Brucella abortus bv. 9 str.
           C68]
 gi|256264100|ref|ZP_05466632.1| immunogenic membrane protein yajC [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369318|ref|YP_003106826.1| preprotein translocase, YajC subunit [Brucella microti CCM 4915]
 gi|260545418|ref|ZP_05821159.1| immunogenic membrane protein yajC [Brucella abortus NCTC 8038]
 gi|260563916|ref|ZP_05834402.1| immunogenic membrane protein yajC [Brucella melitensis bv. 1 str.
           16M]
 gi|260566553|ref|ZP_05837023.1| immunogenic membrane protein yajC [Brucella suis bv. 4 str. 40]
 gi|260754640|ref|ZP_05866988.1| immunogenic membrane protein yajC [Brucella abortus bv. 6 str. 870]
 gi|260757863|ref|ZP_05870211.1| immunogenic membrane protein yajC [Brucella abortus bv. 4 str. 292]
 gi|260761686|ref|ZP_05874029.1| immunogenic membrane protein yajC [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883666|ref|ZP_05895280.1| immunogenic membrane protein yajC [Brucella abortus bv. 9 str. C68]
 gi|261213890|ref|ZP_05928171.1| immunogenic membrane protein yajC [Brucella abortus bv. 3 str.
           Tulya]
 gi|261324997|ref|ZP_05964194.1| immunogenic membrane protein yajC [Brucella neotomae 5K33]
 gi|261752208|ref|ZP_05995917.1| immunogenic membrane protein yajC [Brucella suis bv. 5 str. 513]
 gi|261754867|ref|ZP_05998576.1| immunogenic membrane protein yajC [Brucella suis bv. 3 str. 686]
 gi|265990989|ref|ZP_06103546.1| immunogenic membrane protein yajC [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994826|ref|ZP_06107383.1| immunogenic membrane protein yajC [Brucella melitensis bv. 3 str.
           Ether]
 gi|294852245|ref|ZP_06792918.1| immunogenic membrane protein yajC [Brucella sp. NVSL 07-0026]
 gi|297248240|ref|ZP_06931958.1| immunogenic membrane protein yajC [Brucella abortus bv. 5 str.
           B3196]
 gi|306843788|ref|ZP_07476386.1| preprotein translocase, YajC subunit [Brucella sp. BO1]
 gi|61250561|sp|P0A4Q1|YAJC_BRUME RecName: Full=Immunogenic membrane protein yajC
 gi|61250563|sp|P0A4Q2|YAJC_BRUSU RecName: Full=Immunogenic membrane protein yajC
 gi|88979933|sp|Q2YNM1|YAJC_BRUA2 RecName: Full=Immunogenic membrane protein yajC
 gi|90101609|sp|P0C120|YAJC_BRUAB RecName: Full=Immunogenic membrane protein yajC
 gi|3982835|gb|AAC83690.1| putative membrane protein [Brucella abortus]
 gi|23347706|gb|AAN29818.1| preprotein translocase, YajC subunit [Brucella suis 1330]
 gi|62195967|gb|AAX74267.1| preprotein translocase, YajC subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615861|emb|CAJ10865.1| YajC [Brucella melitensis biovar Abortus 2308]
 gi|161335661|gb|ABX61966.1| preprotein translocase, YajC subunit [Brucella canis ATCC 23365]
 gi|163673884|gb|ABY37995.1| preprotein translocase, YajC subunit [Brucella suis ATCC 23445]
 gi|189019648|gb|ACD72370.1| YajC [Brucella abortus S19]
 gi|225640768|gb|ACO00682.1| preprotein translocase, YajC subunit [Brucella melitensis ATCC
           23457]
 gi|255999478|gb|ACU47877.1| preprotein translocase, YajC subunit [Brucella microti CCM 4915]
 gi|260096825|gb|EEW80700.1| immunogenic membrane protein yajC [Brucella abortus NCTC 8038]
 gi|260153932|gb|EEW89024.1| immunogenic membrane protein yajC [Brucella melitensis bv. 1 str.
           16M]
 gi|260156071|gb|EEW91151.1| immunogenic membrane protein yajC [Brucella suis bv. 4 str. 40]
 gi|260668181|gb|EEX55121.1| immunogenic membrane protein yajC [Brucella abortus bv. 4 str. 292]
 gi|260672118|gb|EEX58939.1| immunogenic membrane protein yajC [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674748|gb|EEX61569.1| immunogenic membrane protein yajC [Brucella abortus bv. 6 str. 870]
 gi|260873194|gb|EEX80263.1| immunogenic membrane protein yajC [Brucella abortus bv. 9 str. C68]
 gi|260915497|gb|EEX82358.1| immunogenic membrane protein yajC [Brucella abortus bv. 3 str.
           Tulya]
 gi|261300977|gb|EEY04474.1| immunogenic membrane protein yajC [Brucella neotomae 5K33]
 gi|261741961|gb|EEY29887.1| immunogenic membrane protein yajC [Brucella suis bv. 5 str. 513]
 gi|261744620|gb|EEY32546.1| immunogenic membrane protein yajC [Brucella suis bv. 3 str. 686]
 gi|262765939|gb|EEZ11728.1| immunogenic membrane protein yajC [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001773|gb|EEZ14348.1| immunogenic membrane protein yajC [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094302|gb|EEZ18163.1| immunogenic membrane protein yajC [Brucella melitensis bv. 2 str.
           63/9]
 gi|294820834|gb|EFG37833.1| immunogenic membrane protein yajC [Brucella sp. NVSL 07-0026]
 gi|297175409|gb|EFH34756.1| immunogenic membrane protein yajC [Brucella abortus bv. 5 str.
           B3196]
 gi|306275866|gb|EFM57582.1| preprotein translocase, YajC subunit [Brucella sp. BO1]
 gi|326408910|gb|ADZ65975.1| YajC [Brucella melitensis M28]
 gi|326538628|gb|ADZ86843.1| preprotein translocase, YajC subunit [Brucella melitensis M5-90]
          Length = 113

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 53/109 (48%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+    +      L     F ++ V+ YFL+IRPQR Q+++R EML ++RRG
Sbjct: 1   MFVTPAFAQASGSVVGP--DMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRG 58

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  GIVGKV++V+DD ELE+EIA+ VR+RVVR+ + +V+ K EPV
Sbjct: 59  DTVVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPV 107


>gi|328947787|ref|YP_004365124.1| preprotein translocase, YajC subunit [Treponema succinifaciens DSM
           2489]
 gi|328448111|gb|AEB13827.1| preprotein translocase, YajC subunit [Treponema succinifaciens DSM
           2489]
          Length = 141

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 3/104 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +F ++  Q+  PA         M     ++  + YF +IRPQ ++ +   +ML  L++GD
Sbjct: 2   LFNSLLLQAADPAAMGGG--FGMFLPLILIIGIMYFFMIRPQNKKQKELQKMLDALQKGD 59

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQS 103
            ++T  GI G V  V  D   + + + EN ++   RS ++ V S
Sbjct: 60  KVITIGGIHGTVSSVKKDSNVVTIRVDENTKIEFNRSAIATVVS 103


>gi|148559710|ref|YP_001258869.1| preprotein translocase, YajC subunit [Brucella ovis ATCC 25840]
 gi|148370967|gb|ABQ60946.1| preprotein translocase, YajC subunit [Brucella ovis ATCC 25840]
          Length = 113

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           T  +AQ+    +      L     F ++ V+ YFL+IRPQR Q+++R EML ++RRGD++
Sbjct: 4   TPAFAQASGSVVGP--DMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRGDTV 61

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           VT  GIVGKV++V+DD ELE+EIA+ VR+RVVR+ + +V+ K EPV
Sbjct: 62  VTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPV 107


>gi|134294794|ref|YP_001118529.1| preprotein translocase subunit YajC [Burkholderia vietnamiensis G4]
 gi|134137951|gb|ABO53694.1| protein translocase subunit yajC [Burkholderia vietnamiensis G4]
          Length = 107

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ        A S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQGA----GGAESSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 59

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ G+VGKV +V +   + VEIAE   + V +S V+ +  K  
Sbjct: 60  VVTSGGLVGKVTKVSEG-YIGVEIAEGTEITVQKSAVTTILPKGT 103


>gi|89256207|ref|YP_513569.1| preprotein translocase family protein [Francisella tularensis
           subsp. holarctica LVS]
 gi|89144038|emb|CAJ79286.1| preprotein translocase family protein [Francisella tularensis
           subsp. holarctica LVS]
          Length = 118

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 65/103 (63%), Gaps = 4/103 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           +T +AQ    A  SA SPL    +  V   +++FLLIRPQ+++ +   +ML  L +GD +
Sbjct: 16  STSFAQ---GAEQSAGSPLSSILMLVVFFAIFWFLLIRPQQKKNKELRKMLSELSKGDEV 72

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           VT  G+VGK+ ++ D+  +++E+A+NV V++ R+ V+ +  K 
Sbjct: 73  VTNGGMVGKIAKI-DETFVDLEVADNVTVKIQRNAVANILPKG 114


>gi|153009665|ref|YP_001370880.1| preprotein translocase subunit YajC [Ochrobactrum anthropi ATCC
           49188]
 gi|151561553|gb|ABS15051.1| preprotein translocase, YajC subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 113

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 56/109 (51%), Positives = 76/109 (69%), Gaps = 3/109 (2%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+   A+      L     F ++ V+ YFL+IRPQR Q+++R EML  +RRG
Sbjct: 1   MFVTPAFAQASGGAVGP--DMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLTQVRRG 58

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  GIVGKV +V+DD ELEVEIAE VR+RV+RS + +V+ K EPV
Sbjct: 59  DTVVTGGGIVGKVQKVVDDNELEVEIAEGVRIRVMRSTLMDVRVKGEPV 107


>gi|46201934|ref|ZP_00054073.2| COG1862: Preprotein translocase subunit YajC [Magnetospirillum
           magnetotacticum MS-1]
          Length = 128

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 48/88 (54%), Positives = 67/88 (76%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           LE      ++ VV+YFLLIRPQ+++++   EML  LRRGD +VTA GI+G V ++I+D E
Sbjct: 23  LEQFLPLILIFVVFYFLLIRPQQKKMKLHKEMLGQLRRGDRVVTAGGIIGTVNKLINDTE 82

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           + VEIAE VRVRV+R+ ++EV SK+EPV
Sbjct: 83  VSVEIAEGVRVRVLRATITEVLSKTEPV 110


>gi|56708194|ref|YP_170090.1| preprotein translocase family protein [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110670665|ref|YP_667222.1| preprotein translocase family protein [Francisella tularensis
           subsp. tularensis FSC198]
 gi|115314674|ref|YP_763397.1| preprotein translocase subunit [Francisella tularensis subsp.
           holarctica OSU18]
 gi|118497686|ref|YP_898736.1| preprotein translocase family protein [Francisella tularensis
           subsp. novicida U112]
 gi|134302106|ref|YP_001122075.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|167009756|ref|ZP_02274687.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           holarctica FSC200]
 gi|169656578|ref|YP_001428331.2| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187931933|ref|YP_001891918.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194323658|ref|ZP_03057434.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           novicida FTE]
 gi|208779750|ref|ZP_03247094.1| preprotein translocase, YajC subunit [Francisella novicida FTG]
 gi|224457297|ref|ZP_03665770.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254367533|ref|ZP_04983559.1| preprotein translocase family protein [Francisella tularensis
           subsp. holarctica 257]
 gi|254370681|ref|ZP_04986686.1| preprotein translocase family protein [Francisella tularensis
           subsp. tularensis FSC033]
 gi|254373052|ref|ZP_04988541.1| hypothetical protein FTCG_00627 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254374504|ref|ZP_04989985.1| hypothetical protein FTDG_00675 [Francisella novicida GA99-3548]
 gi|254875006|ref|ZP_05247716.1| preprotein translocase family protein yajC [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|290952964|ref|ZP_06557585.1| preprotein translocase family protein [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313836|ref|ZP_06804408.1| preprotein translocase family protein [Francisella tularensis
           subsp. holarctica URFT1]
 gi|56604686|emb|CAG45749.1| preprotein translocase family protein [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320998|emb|CAL09132.1| preprotein translocase family protein [Francisella tularensis
           subsp. tularensis FSC198]
 gi|115129573|gb|ABI82760.1| preprotein translocase subunit [Francisella tularensis subsp.
           holarctica OSU18]
 gi|118423592|gb|ABK89982.1| preprotein translocase family protein [Francisella novicida U112]
 gi|134049883|gb|ABO46954.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|134253349|gb|EBA52443.1| preprotein translocase family protein [Francisella tularensis
           subsp. holarctica 257]
 gi|151568924|gb|EDN34578.1| preprotein translocase family protein [Francisella tularensis
           subsp. tularensis FSC033]
 gi|151570779|gb|EDN36433.1| hypothetical protein FTCG_00627 [Francisella novicida GA99-3549]
 gi|151572223|gb|EDN37877.1| hypothetical protein FTDG_00675 [Francisella novicida GA99-3548]
 gi|164551646|gb|ABU61375.2| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187712842|gb|ACD31139.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194322022|gb|EDX19504.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           novicida FTE]
 gi|208744205|gb|EDZ90505.1| preprotein translocase, YajC subunit [Francisella novicida FTG]
 gi|254841005|gb|EET19441.1| preprotein translocase family protein yajC [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|282159410|gb|ADA78801.1| preprotein translocase, YajC subunit [Francisella tularensis subsp.
           tularensis NE061598]
 gi|332678399|gb|AEE87528.1| Preprotein translocase subunit YajC [Francisella cf. novicida Fx1]
          Length = 118

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 63/103 (61%), Gaps = 4/103 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           +T +AQ    A     SPL    +  V   +++FLLIRPQ+++ +   +ML  L +GD +
Sbjct: 16  STSFAQGAEQAA---GSPLSSILMLVVFFAIFWFLLIRPQQKKNKELRKMLSELSKGDEV 72

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           VT  G+VGK+ ++ D+  +++E+A+NV V++ R+ V+ +  K 
Sbjct: 73  VTNGGMVGKIAKI-DETFVDLEVADNVTVKIQRNAVANILPKG 114


>gi|330815588|ref|YP_004359293.1| Preprotein translocase, YajC subunit [Burkholderia gladioli BSR3]
 gi|327367981|gb|AEA59337.1| Preprotein translocase, YajC subunit [Burkholderia gladioli BSR3]
          Length = 108

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 4/106 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +AQ    A  SA S L       ++  V YF++IRPQ ++ +    ML  + +GD
Sbjct: 3   IISNAFAQ---GAGGSAESSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT  G+VGKV +V +   + VE++E   + V +S V+ +  K  
Sbjct: 60  EVVTNGGLVGKVTKVGEA-YVGVEVSEGTEITVQKSAVTTILPKGT 104


>gi|21231814|ref|NP_637731.1| preprotein translocase subunit YajC [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768060|ref|YP_242822.1| preprotein translocase subunit YajC [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991191|ref|YP_001903201.1| preprotein translocase subunit YajC [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113528|gb|AAM41655.1| preprotein translocase YajC subunit [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573392|gb|AAY48802.1| preprotein translocase YajC subunit [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167732951|emb|CAP51147.1| putative membrane protein [Xanthomonas campestris pv. campestris]
          Length = 117

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSAT-SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           +     AQ+   A        L    L  +L  V YFL+IRPQ ++ +    +L  L RG
Sbjct: 7   LIPVAQAQATGGAPAPGPMGSLSTFALPIILIAVMYFLMIRPQMKRQKEHKALLDKLSRG 66

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D ++T+ G+ G +  + ++  + VE+A+NVR+RV RS V  V  K  
Sbjct: 67  DEVITSGGVAGVITDIGENF-ITVEVADNVRIRVQRSAVGHVLPKGT 112


>gi|24374631|ref|NP_718674.1| preprotein translocase subunit YajC [Shewanella oneidensis MR-1]
 gi|24349258|gb|AAN56118.1|AE015748_6 preprotein translocase, YajC subunit [Shewanella oneidensis MR-1]
          Length = 110

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA +        T  +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD 
Sbjct: 3   ISNAYANAAGTPQGGGT--MELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLGKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T+ GI+GK+ ++ DD   + + + +  ++ + + +++ V  K 
Sbjct: 61  VLTSGGILGKIAKISDDNDYVLLSLNDTTQITIKKDYIAAVLPKG 105


>gi|254706900|ref|ZP_05168728.1| hypothetical protein BpinM_07916 [Brucella pinnipedialis
           M163/99/10]
 gi|254709992|ref|ZP_05171803.1| hypothetical protein BpinB_06901 [Brucella pinnipedialis B2/94]
 gi|254713993|ref|ZP_05175804.1| hypothetical protein BcetM6_11676 [Brucella ceti M644/93/1]
 gi|254716948|ref|ZP_05178759.1| hypothetical protein BcetM_11102 [Brucella ceti M13/05/1]
 gi|256031486|ref|ZP_05445100.1| hypothetical protein BpinM2_12673 [Brucella pinnipedialis
           M292/94/1]
 gi|256159612|ref|ZP_05457374.1| hypothetical protein BcetM4_11648 [Brucella ceti M490/95/1]
 gi|256254892|ref|ZP_05460428.1| hypothetical protein BcetB_11465 [Brucella ceti B1/94]
 gi|260168620|ref|ZP_05755431.1| hypothetical protein BruF5_09664 [Brucella sp. F5/99]
 gi|261218753|ref|ZP_05933034.1| immunogenic membrane protein yajC [Brucella ceti M13/05/1]
 gi|261222075|ref|ZP_05936356.1| immunogenic membrane protein yajC [Brucella ceti B1/94]
 gi|261314363|ref|ZP_05953560.1| immunogenic membrane protein yajC [Brucella pinnipedialis
           M163/99/10]
 gi|261317541|ref|ZP_05956738.1| immunogenic membrane protein yajC [Brucella pinnipedialis B2/94]
 gi|261321748|ref|ZP_05960945.1| immunogenic membrane protein yajC [Brucella ceti M644/93/1]
 gi|261758094|ref|ZP_06001803.1| immunogenic membrane protein yajC [Brucella sp. F5/99]
 gi|265988575|ref|ZP_06101132.1| immunogenic membrane protein yajC [Brucella pinnipedialis
           M292/94/1]
 gi|265998040|ref|ZP_06110597.1| immunogenic membrane protein yajC [Brucella ceti M490/95/1]
 gi|260920659|gb|EEX87312.1| immunogenic membrane protein yajC [Brucella ceti B1/94]
 gi|260923842|gb|EEX90410.1| immunogenic membrane protein yajC [Brucella ceti M13/05/1]
 gi|261294438|gb|EEX97934.1| immunogenic membrane protein yajC [Brucella ceti M644/93/1]
 gi|261296764|gb|EEY00261.1| immunogenic membrane protein yajC [Brucella pinnipedialis B2/94]
 gi|261303389|gb|EEY06886.1| immunogenic membrane protein yajC [Brucella pinnipedialis
           M163/99/10]
 gi|261738078|gb|EEY26074.1| immunogenic membrane protein yajC [Brucella sp. F5/99]
 gi|262552508|gb|EEZ08498.1| immunogenic membrane protein yajC [Brucella ceti M490/95/1]
 gi|264660772|gb|EEZ31033.1| immunogenic membrane protein yajC [Brucella pinnipedialis
           M292/94/1]
          Length = 113

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 52/109 (47%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+    +      L     F ++ V+ YFL+IRPQR Q+++R +ML ++RRG
Sbjct: 1   MFVTPAFAQASGSVVGP--DMLMSILPFILIFVIMYFLIIRPQRTQMKKRQKMLNSVRRG 58

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  GIVGKV++V+DD ELE+EIA+ VR+RVVR+ + +V+ K EPV
Sbjct: 59  DTVVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPV 107


>gi|253990963|ref|YP_003042319.1| hypothetical protein PAU_03489 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782413|emb|CAQ85577.1| Hypothetical protein yajC [Photorhabdus asymbiotica]
          Length = 132

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 52/90 (57%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V +V 
Sbjct: 39  QGSPYSLIIMLVVFGLIFYFMILRPQQKRTKEHKKLMDSISKGDEVLTNGGLIGRVTKVS 98

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D   + V + +   V + R FV+ V  K  
Sbjct: 99  DTGYVVVALNDTTEVTIKRDFVAAVLPKGT 128


>gi|329905133|ref|ZP_08274052.1| Preprotein translocase subunit YajC [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547693|gb|EGF32478.1| Preprotein translocase subunit YajC [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 109

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQS        +S L       ++ VV YFL+IRPQ ++ + +  M+  L +GD 
Sbjct: 3   ITNAYAQS-PLDGLGLSSNLTSFLPIILMFVVLYFLMIRPQMKRQKEQKSMMDALAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ GI+GKV +V  D  L +E+A+   V V +  VS +  K  
Sbjct: 62  VVTSGGILGKVTKVT-DAYLTIEVADGTEVLVQKGAVSTLLPKGT 105


>gi|190891520|ref|YP_001978062.1| preprotein tranlocase subunit YajC [Rhizobium etli CIAT 652]
 gi|190696799|gb|ACE90884.1| preprotein tranlocase protein subunit YajC [Rhizobium etli CIAT
           652]
          Length = 106

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 70/97 (72%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
           P      S  EM  LF  L VVWYFLLIRPQR Q ++R E L+ +RRGD +VT  G+VGK
Sbjct: 5   PQPGFGGSGFEMIILFVPLMVVWYFLLIRPQRAQAKKREETLKAIRRGDQVVTGGGLVGK 64

Query: 72  VVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           V +V+DD E+EVEIAE VRVR+VRS +SEV+ K EPV
Sbjct: 65  VTKVVDDKEVEVEIAEGVRVRIVRSGISEVRVKGEPV 101


>gi|30249129|ref|NP_841199.1| hypothetical protein NE1142 [Nitrosomonas europaea ATCC 19718]
 gi|30180448|emb|CAD85053.1| Domain of unknown function DUF219 [Nitrosomonas europaea ATCC
           19718]
          Length = 158

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  +AQ+   A  ++   L        + V++YFLLIRPQ ++ + + EM   L++GD
Sbjct: 2   LITEAFAQTANGAAQTSDPTLMSFLPMIGILVIFYFLLIRPQTKRAKEQKEMQNGLQKGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            IV + G +G+VV    D  + +EIA  V + V++S V  +  K  
Sbjct: 62  EIVISGGELGRVVSA-GDSYITMEIATGVEIIVLKSSVQTLLPKGT 106


>gi|325915105|ref|ZP_08177431.1| protein translocase subunit yajC (SecM) [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538627|gb|EGD10297.1| protein translocase subunit yajC (SecM) [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 117

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSAT-SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           +     AQ+   A        L    L  +L  V YFL+IRPQ ++ +    +L  L RG
Sbjct: 7   LIPVAQAQATGGAPAPGPMGSLSTFALPIILIAVMYFLMIRPQMKRQKEHKSLLDKLARG 66

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D ++T+ G+ G +  +  D  + VE+A+NVR+RV +S V  V  K  
Sbjct: 67  DEVITSGGVAGVITDI-GDNFISVEVADNVRIRVQKSAVGHVLPKGT 112


>gi|192361058|ref|YP_001982140.1| preprotein translocase subunit YajC [Cellvibrio japonicus Ueda107]
 gi|190687223|gb|ACE84901.1| preprotein translocase, YajC subunit [Cellvibrio japonicus Ueda107]
          Length = 113

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++  AQ+ A       SPL    LF  + +  Y L+IRPQR++ +    ++ +L +GD 
Sbjct: 5   ISSAMAQTQA--APPQGSPLVTLLLFGGMFLFMYLLIIRPQRKRQKEHQNLVASLAKGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++  +G++GK+V+V D+  + +E   N+ ++  +  V  V  K  
Sbjct: 63  VLMTSGLLGKIVKV-DENYVVLETGSNIELKFQKVAVHAVLPKGT 106


>gi|328675961|gb|AEB28636.1| Preprotein translocase subunit YajC [Francisella cf. novicida 3523]
          Length = 118

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 65/103 (63%), Gaps = 4/103 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           +T +AQ    A  SA SPL    +  V   +++FLLIRPQ+++ +   +ML  L +GD +
Sbjct: 16  STSFAQ---GAEQSAGSPLSSILMLVVFFAIFWFLLIRPQQKKNKELRKMLSELSKGDEV 72

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           VT  G+VGK+ ++ D+  +++E+AENV V++ RS V+ +  K 
Sbjct: 73  VTNGGMVGKIAKI-DETFVDLEVAENVTVKIQRSAVANILPKG 114


>gi|91781854|ref|YP_557060.1| preprotein translocase subunit YajC [Burkholderia xenovorans LB400]
 gi|91685808|gb|ABE29008.1| protein translocase subunit yajC [Burkholderia xenovorans LB400]
          Length = 120

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ    A     S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 15  ISNAFAQ--GTATGGIESNLMSFLPLILMFGVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 72

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVGKV +V +   + VEI+E   + V ++ V+ +  K  
Sbjct: 73  VVTNGGIVGKVTKVGEA-YVGVEISEGTEITVQKASVTTILPKGT 116


>gi|254369201|ref|ZP_04985213.1| hypothetical protein FTAG_00150 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122151|gb|EDO66291.1| hypothetical protein FTAG_00150 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 63/103 (61%), Gaps = 4/103 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           +T +AQ    A     SPL    +  V   +++FLLIRPQ+++ +   +ML  L +GD +
Sbjct: 16  STSFAQGAEQAA---GSPLSAILMLVVFFAIFWFLLIRPQQKKNKELRKMLSELSKGDEV 72

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           VT  G+VGK+ ++ D+  +++E+A+NV V++ R+ V+ +  K 
Sbjct: 73  VTNGGMVGKIAKI-DETFVDLEVADNVTVKIQRNAVANILPKG 114


>gi|220922171|ref|YP_002497472.1| preprotein translocase subunit YajC [Methylobacterium nodulans ORS
           2060]
 gi|219946777|gb|ACL57169.1| preprotein translocase, YajC subunit [Methylobacterium nodulans ORS
           2060]
          Length = 111

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/109 (47%), Positives = 76/109 (69%), Gaps = 2/109 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M T  +AQ    A  S T  +     F ++ V+ YFL++RPQ+++ +   +M++N+RRGD
Sbjct: 1   MITPAFAQGTG-AAASGTDIILQVVPFVLIFVIMYFLILRPQQRRAREHQDMVKNVRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +IVT  GIVG+V RV DD  E+EVEIAE VRV+VVR+ ++EV++K EPV
Sbjct: 60  TIVTTGGIVGRVARVTDDASEIEVEIAEGVRVKVVRTMIAEVRAKGEPV 108


>gi|85711203|ref|ZP_01042263.1| Preprotein translocase subunit YajC [Idiomarina baltica OS145]
 gi|85695116|gb|EAQ33054.1| Preprotein translocase subunit YajC [Idiomarina baltica OS145]
          Length = 111

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YAQ  A A       +E+  +  +  +V+YFL+ RPQ +++++  E++ +L +GD 
Sbjct: 5   ISPAYAQDGAAAQGGG---MELIIMLLLFGLVFYFLIYRPQAKRMKQHKELIGSLSKGDE 61

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VGK+ +V DD   + + ++E + V V ++ V+ V  K  
Sbjct: 62  VLTQGGMVGKITKVSDDKDFIVIALSEEMEVTVQKAAVTSVLPKGT 107


>gi|161525834|ref|YP_001580846.1| preprotein translocase subunit YajC [Burkholderia multivorans ATCC
           17616]
 gi|189349445|ref|YP_001945073.1| preprotein translocase subunit YajC [Burkholderia multivorans ATCC
           17616]
 gi|221202264|ref|ZP_03575298.1| preprotein translocase, YajC subunit [Burkholderia multivorans
           CGD2M]
 gi|221209146|ref|ZP_03582139.1| preprotein translocase, YajC subunit [Burkholderia multivorans
           CGD2]
 gi|221214468|ref|ZP_03587439.1| preprotein translocase, YajC subunit [Burkholderia multivorans
           CGD1]
 gi|254253197|ref|ZP_04946515.1| YajC [Burkholderia dolosa AUO158]
 gi|124895806|gb|EAY69686.1| YajC [Burkholderia dolosa AUO158]
 gi|160343263|gb|ABX16349.1| preprotein translocase, YajC subunit [Burkholderia multivorans ATCC
           17616]
 gi|189333467|dbj|BAG42537.1| preprotein translocase YajC subunit [Burkholderia multivorans ATCC
           17616]
 gi|221165725|gb|EED98200.1| preprotein translocase, YajC subunit [Burkholderia multivorans
           CGD1]
 gi|221170964|gb|EEE03418.1| preprotein translocase, YajC subunit [Burkholderia multivorans
           CGD2]
 gi|221177838|gb|EEE10251.1| preprotein translocase, YajC subunit [Burkholderia multivorans
           CGD2M]
 gi|325523864|gb|EGD02089.1| preprotein translocase subunit YajC [Burkholderia sp. TJI49]
          Length = 107

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ        A S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQGA----GGAESSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 59

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ G+VGKV +V +   + VEIAE   + V ++ V+ +  K  
Sbjct: 60  VVTSGGLVGKVTKVSEG-YIGVEIAEGTEITVQKAAVTTILPKGT 103


>gi|170691382|ref|ZP_02882547.1| preprotein translocase, YajC subunit [Burkholderia graminis C4D1M]
 gi|170143587|gb|EDT11750.1| preprotein translocase, YajC subunit [Burkholderia graminis C4D1M]
          Length = 110

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ  A       S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQGTAT-GGGIESNLMSFLPLILMFGVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVGKV +V +   + VEI+E   + V ++ V+ +  K  
Sbjct: 63  VVTNGGIVGKVTKVGEA-YVGVEISEGTEITVQKASVTTILPKGT 106


>gi|78065285|ref|YP_368054.1| preprotein translocase subunit YajC [Burkholderia sp. 383]
 gi|107021797|ref|YP_620124.1| preprotein translocase subunit YajC [Burkholderia cenocepacia AU
           1054]
 gi|115350665|ref|YP_772504.1| preprotein translocase subunit YajC [Burkholderia ambifaria AMMD]
 gi|116688744|ref|YP_834367.1| preprotein translocase subunit YajC [Burkholderia cenocepacia
           HI2424]
 gi|170703129|ref|ZP_02893945.1| preprotein translocase, YajC subunit [Burkholderia ambifaria
           IOP40-10]
 gi|170732042|ref|YP_001763989.1| preprotein translocase subunit YajC [Burkholderia cenocepacia
           MC0-3]
 gi|171320043|ref|ZP_02909113.1| preprotein translocase, YajC subunit [Burkholderia ambifaria MEX-5]
 gi|172059697|ref|YP_001807349.1| preprotein translocase subunit YajC [Burkholderia ambifaria MC40-6]
 gi|206561643|ref|YP_002232408.1| preprotein translocase subunit YajC [Burkholderia cenocepacia
           J2315]
 gi|254246281|ref|ZP_04939602.1| YajC [Burkholderia cenocepacia PC184]
 gi|77966030|gb|ABB07410.1| protein translocase subunit yajC [Burkholderia sp. 383]
 gi|105891986|gb|ABF75151.1| protein translocase subunit yajC [Burkholderia cenocepacia AU 1054]
 gi|115280653|gb|ABI86170.1| protein translocase subunit yajC [Burkholderia ambifaria AMMD]
 gi|116646833|gb|ABK07474.1| protein translocase subunit yajC [Burkholderia cenocepacia HI2424]
 gi|124871057|gb|EAY62773.1| YajC [Burkholderia cenocepacia PC184]
 gi|169815284|gb|ACA89867.1| preprotein translocase, YajC subunit [Burkholderia cenocepacia
           MC0-3]
 gi|170131962|gb|EDT00474.1| preprotein translocase, YajC subunit [Burkholderia ambifaria
           IOP40-10]
 gi|171094702|gb|EDT39746.1| preprotein translocase, YajC subunit [Burkholderia ambifaria MEX-5]
 gi|171992214|gb|ACB63133.1| preprotein translocase, YajC subunit [Burkholderia ambifaria
           MC40-6]
 gi|198037685|emb|CAR53628.1| preprotein translocase subunit [Burkholderia cenocepacia J2315]
          Length = 107

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ        A S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQGA----GGAESSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 59

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ G+VGKV +V +   + VEIAE   + V ++ V+ +  K  
Sbjct: 60  VVTSGGLVGKVTKVTEG-YIGVEIAEGTEITVQKAAVTTILPKGT 103


>gi|307728503|ref|YP_003905727.1| preprotein translocase, YajC subunit [Burkholderia sp. CCGE1003]
 gi|307583038|gb|ADN56436.1| preprotein translocase, YajC subunit [Burkholderia sp. CCGE1003]
          Length = 109

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ    A     S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQ--GTAAGGVESNLMSFLPLILMFGVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVGKV +V +   + VEI+E   + V ++ ++ +  K  
Sbjct: 62  VVTNGGIVGKVTKVGEA-YVGVEISEGTEITVQKASITTILPKGT 105


>gi|120598343|ref|YP_962917.1| preprotein translocase subunit YajC [Shewanella sp. W3-18-1]
 gi|146293579|ref|YP_001184003.1| preprotein translocase subunit YajC [Shewanella putrefaciens CN-32]
 gi|120558436|gb|ABM24363.1| protein translocase subunit yajC [Shewanella sp. W3-18-1]
 gi|145565269|gb|ABP76204.1| protein translocase subunit yajC [Shewanella putrefaciens CN-32]
 gi|319426878|gb|ADV54952.1| preprotein translocase, YajC subunit [Shewanella putrefaciens 200]
          Length = 110

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA +        T  +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD 
Sbjct: 3   ISNAYASAAGAPQGGGT--MELIFMLAIFGLIFYFMIFRPQSKRVKEHKNLMSSLGKGDE 60

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T+ GI+GK+ ++ DD   + + + +  ++ + + +++ V  K 
Sbjct: 61  VLTSGGILGKIAKISDDSDYVLLSLNDTTQITIKKDYIAAVLPKG 105


>gi|254718994|ref|ZP_05180805.1| hypothetical protein Bru83_05544 [Brucella sp. 83/13]
 gi|265983985|ref|ZP_06096720.1| immunogenic membrane protein yajC [Brucella sp. 83/13]
 gi|306840120|ref|ZP_07472906.1| preprotein translocase, YajC subunit [Brucella sp. NF 2653]
 gi|264662577|gb|EEZ32838.1| immunogenic membrane protein yajC [Brucella sp. 83/13]
 gi|306404848|gb|EFM61141.1| preprotein translocase, YajC subunit [Brucella sp. NF 2653]
          Length = 113

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/109 (48%), Positives = 77/109 (70%), Gaps = 3/109 (2%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+    +      L     F ++ V+ YFL+IRPQR Q+++R EML ++RRG
Sbjct: 1   MFVTQAFAQASGSVVGP--DMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRG 58

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  GIVGKV++V+DD ELE+EIA+ VR+RVVR+ + +V+ K EPV
Sbjct: 59  DTVVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPV 107


>gi|166711671|ref|ZP_02242878.1| preprotein translocase subunit YajC [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 117

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSAT-SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           +     AQ+   A        L    L  +L  V YFL+IRPQ ++ +    +L  L RG
Sbjct: 7   LIPAAQAQATGIAPAPGPLGGLSTFALPVILIAVMYFLMIRPQMKRQKEHKSLLDKLARG 66

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D ++T+ G+ G +  +  D  + VE+A+NVR+RV +S V  V  K  
Sbjct: 67  DEVITSGGVAGVITEI-GDNFISVEVADNVRIRVQKSAVGHVLPKGT 112


>gi|113969725|ref|YP_733518.1| preprotein translocase subunit YajC [Shewanella sp. MR-4]
 gi|113884409|gb|ABI38461.1| protein translocase subunit yajC [Shewanella sp. MR-4]
          Length = 110

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA +        T  +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD 
Sbjct: 3   ISNAYANAAGAPQGGGT--MELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLTKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T+ GI+GK+ ++ D+   + + + +  ++ + + +++ V  K 
Sbjct: 61  VLTSGGILGKIAKISDENDYVLLSLNDTTQITIKKDYIAAVLPKG 105


>gi|307579203|gb|ADN63172.1| preprotein translocase subunit YajC [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 116

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
                AQS APA  S    L+M  L  +L  V YF +IRPQ ++ +    M+ +L  GD 
Sbjct: 8   IPVAQAQSAAPAGASPGGGLQMFFLPVILIAVMYFSIIRPQMKRQKEYKTMMDHLGCGDE 67

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++TA GI G VV VI D  + VEIAENVRVRV +S +++   K 
Sbjct: 68  VITAGGIAG-VVSVIGDEFVTVEIAENVRVRVQKSAIAKALPKG 110


>gi|254476742|ref|ZP_05090128.1| preprotein translocase, YajC subunit [Ruegeria sp. R11]
 gi|214030985|gb|EEB71820.1| preprotein translocase, YajC subunit [Ruegeria sp. R11]
          Length = 94

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/90 (45%), Positives = 62/90 (68%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + YFLLIRPQ+++++    M+  LRRGD +VT  G++GKV +V D
Sbjct: 3   GGAIAQFLPLILIFGIMYFLLIRPQQKKMKEHQNMVAALRRGDQVVTQGGVIGKVSKVKD 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D ELEVEIAE V++RVV+S +++V SK+EP
Sbjct: 63  DGELEVEIAEGVKIRVVKSTIAQVLSKTEP 92


>gi|319408338|emb|CBI81991.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 152

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/108 (47%), Positives = 73/108 (67%), Gaps = 3/108 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ+      S  S L     F ++  + YFL+IRPQR Q+++R EML  +RRGD+
Sbjct: 3   ITNAYAQAAG--GISGGSSLITFVPFILIFAIMYFLIIRPQRTQMKKRQEMLNAVRRGDT 60

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +VT  GI+GKV +V D+  ELEVEI ++VR+RVVRS +++V+ K EP+
Sbjct: 61  VVTGGGIIGKVTKVYDEQGELEVEINDSVRIRVVRSTLADVRIKGEPL 108


>gi|323524788|ref|YP_004226941.1| preprotein translocase subunit YajC [Burkholderia sp. CCGE1001]
 gi|323381790|gb|ADX53881.1| preprotein translocase, YajC subunit [Burkholderia sp. CCGE1001]
          Length = 109

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ    A     S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQ--GTAAGGVESNLMSFLPLILMFGVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVGKV +V +   + VEI+E   + V ++ V+ +  K  
Sbjct: 62  VVTNGGIVGKVTKVGEA-YVGVEISEGTEITVQKASVTTILPKGT 105


>gi|119503213|ref|ZP_01625297.1| ATPase [marine gamma proteobacterium HTCC2080]
 gi|119460859|gb|EAW41950.1| ATPase [marine gamma proteobacterium HTCC2080]
          Length = 111

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++ YAQS  PA           G   VL  ++YFL IRPQR++ +   +M+  L++GD 
Sbjct: 3   ISSAYAQSAGPAPAGGE--FMQIGFLIVLFALFYFLAIRPQRKRQKEHTDMISALKKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +  ++G++G+V  + D+  L + ++  + ++  R  V+ +  K  
Sbjct: 61  VAMSSGMLGRVTAL-DENYLTLGVSGGLELKFQRLHVNAILPKGT 104


>gi|254480451|ref|ZP_05093698.1| preprotein translocase, YajC subunit [marine gamma proteobacterium
           HTCC2148]
 gi|214039034|gb|EEB79694.1| preprotein translocase, YajC subunit [marine gamma proteobacterium
           HTCC2148]
          Length = 111

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
             + YAQ    A       L   G   +L V++YF+ IRPQR++ +   EM+  L +GD 
Sbjct: 5   IASAYAQEAGQAPQGGE--LFQIGFLVLLFVLFYFIAIRPQRKRQKEHGEMVSALNKGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT++GI+GKV  + DD  + + +A NV ++  R  +  V  K  
Sbjct: 63  VVTSSGILGKVTGL-DDNYMVLNVANNVDMKFQRVHLHAVLPKGT 106


>gi|237707599|ref|ZP_04538080.1| preprotein translocase subunit YajC [Escherichia sp. 3_2_53FAA]
 gi|300936394|ref|ZP_07151322.1| preprotein translocase, YajC subunit [Escherichia coli MS 21-1]
 gi|300988041|ref|ZP_07178521.1| preprotein translocase, YajC subunit [Escherichia coli MS 45-1]
 gi|300997406|ref|ZP_07181746.1| preprotein translocase, YajC subunit [Escherichia coli MS 200-1]
 gi|301025428|ref|ZP_07188979.1| preprotein translocase, YajC subunit [Escherichia coli MS 69-1]
 gi|331640923|ref|ZP_08342058.1| preprotein translocase, YajC subunit [Escherichia coli H736]
 gi|331645580|ref|ZP_08346684.1| preprotein translocase, YajC subunit [Escherichia coli M605]
 gi|331651340|ref|ZP_08352365.1| preprotein translocase, YajC subunit [Escherichia coli M718]
 gi|331676074|ref|ZP_08376786.1| preprotein translocase, YajC subunit [Escherichia coli H591]
 gi|332281553|ref|ZP_08393966.1| preprotein translocase subunit YajC [Shigella sp. D9]
 gi|26106810|gb|AAN78995.1|AE016756_178 Hypothetical protein yajC [Escherichia coli CFT073]
 gi|91071049|gb|ABE05930.1| hypothetical protein YajC [Escherichia coli UTI89]
 gi|226898809|gb|EEH85068.1| preprotein translocase subunit YajC [Escherichia sp. 3_2_53FAA]
 gi|300304225|gb|EFJ58745.1| preprotein translocase, YajC subunit [Escherichia coli MS 200-1]
 gi|300396030|gb|EFJ79568.1| preprotein translocase, YajC subunit [Escherichia coli MS 69-1]
 gi|300407593|gb|EFJ91131.1| preprotein translocase, YajC subunit [Escherichia coli MS 45-1]
 gi|300458500|gb|EFK21993.1| preprotein translocase, YajC subunit [Escherichia coli MS 21-1]
 gi|315289878|gb|EFU49268.1| preprotein translocase, YajC subunit [Escherichia coli MS 110-3]
 gi|315294214|gb|EFU53565.1| preprotein translocase, YajC subunit [Escherichia coli MS 153-1]
 gi|315299573|gb|EFU58821.1| preprotein translocase, YajC subunit [Escherichia coli MS 16-3]
 gi|324010667|gb|EGB79886.1| preprotein translocase, YajC subunit [Escherichia coli MS 60-1]
 gi|324016687|gb|EGB85906.1| preprotein translocase, YajC subunit [Escherichia coli MS 117-3]
 gi|331037721|gb|EGI09941.1| preprotein translocase, YajC subunit [Escherichia coli H736]
 gi|331045742|gb|EGI17868.1| preprotein translocase, YajC subunit [Escherichia coli M605]
 gi|331051081|gb|EGI23133.1| preprotein translocase, YajC subunit [Escherichia coli M718]
 gi|331076132|gb|EGI47414.1| preprotein translocase, YajC subunit [Escherichia coli H591]
 gi|332103905|gb|EGJ07251.1| preprotein translocase subunit YajC [Shigella sp. D9]
          Length = 120

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 15  ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDE 71

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V ++  + + + +   V + R FV+ V  K  
Sbjct: 72  VLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGT 116


>gi|126739017|ref|ZP_01754711.1| preprotein translocase, YajC subunit [Roseobacter sp. SK209-2-6]
 gi|126719634|gb|EBA16342.1| preprotein translocase, YajC subunit [Roseobacter sp. SK209-2-6]
          Length = 92

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 64/90 (71%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            + +       ++  + YFLLIRPQ+++++    M+ N+RRGD +VT  G++GK+ ++ D
Sbjct: 1   MNAIGQFLPLILIFAIMYFLLIRPQQKKMKEHQNMVNNVRRGDQVVTQGGLIGKISKLKD 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVE+AE V+VRVV+S +++V SK+EP
Sbjct: 61  DNEVEVELAEGVKVRVVKSTIAQVISKTEP 90


>gi|59712575|ref|YP_205351.1| preprotein translocase subunit YajC [Vibrio fischeri ES114]
 gi|59480676|gb|AAW86463.1| SecYEG protein translocase auxillary subunit [Vibrio fischeri
           ES114]
          Length = 111

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 58/106 (54%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A  +A         ++M  +  + AV++YF++ RPQ ++ +    ++ ++ +GD 
Sbjct: 5   ISQAHAAGEAAPQGGG---MQMFIMLGMFAVIFYFMIYRPQAKRQKEHKNLMASMSKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++TA G+VGK+ +V ++   + +E+  N  V + + FVS V  K  
Sbjct: 62  VLTAGGLVGKITKVSEENDYIVIELNANNEVTIKKDFVSAVLPKGT 107


>gi|187922706|ref|YP_001894348.1| preprotein translocase subunit YajC [Burkholderia phytofirmans
           PsJN]
 gi|296161044|ref|ZP_06843855.1| preprotein translocase, YajC subunit [Burkholderia sp. Ch1-1]
 gi|187713900|gb|ACD15124.1| preprotein translocase, YajC subunit [Burkholderia phytofirmans
           PsJN]
 gi|295888743|gb|EFG68550.1| preprotein translocase, YajC subunit [Burkholderia sp. Ch1-1]
          Length = 109

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ    A     S L       ++  V YF++IRPQ ++ +    ML  + +GD 
Sbjct: 4   ISNAFAQ--GTATGGIESNLMSFLPLILMFGVLYFIMIRPQMKRQKEHRNMLAAMAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVGKV +V +   + VEI+E   + V ++ V+ +  K  
Sbjct: 62  VVTNGGIVGKVTKVGEA-YVGVEISEGTEITVQKASVTTILPKGT 105


>gi|325919630|ref|ZP_08181639.1| protein translocase subunit yajC (SecM) [Xanthomonas gardneri ATCC
           19865]
 gi|325549878|gb|EGD20723.1| protein translocase subunit yajC (SecM) [Xanthomonas gardneri ATCC
           19865]
          Length = 117

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSAT-SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           +     AQ+   A  +     L    L  +L  V YFL+IRPQ ++ +    +L  L RG
Sbjct: 7   LIPVAQAQATGGAPAAGPMGSLSTFALPIILIAVMYFLMIRPQMKRQKEHKSLLEKLSRG 66

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D ++T+ G+ G +  +  D  + VE+A+NVR+RV +S V  V  K  
Sbjct: 67  DEVITSGGVAGVISDI-GDNFITVEVADNVRIRVQKSAVGHVLPKGT 112


>gi|15836829|ref|NP_297517.1| preprotein translocase subunit YajC [Xylella fastidiosa 9a5c]
 gi|9105033|gb|AAF83037.1|AE003876_2 preprotein translocase YajC subunit [Xylella fastidiosa 9a5c]
          Length = 120

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
                AQS APA  S    L+M  L  +L  V YF +IRPQ ++ +    M+ +L  GD 
Sbjct: 12  IPVAQAQSAAPAGASPGGGLQMFFLPVILIAVMYFSIIRPQMKRQKEYKSMMDHLGCGDE 71

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++TA GI G VV VI D  + VEIAENVRVRV +S +++   K 
Sbjct: 72  VITAGGIAG-VVSVIGDEFVTVEIAENVRVRVQKSAIAKALPKG 114


>gi|197335604|ref|YP_002156796.1| preprotein translocase, YajC subunit [Vibrio fischeri MJ11]
 gi|197317094|gb|ACH66541.1| preprotein translocase, YajC subunit [Vibrio fischeri MJ11]
          Length = 111

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 58/106 (54%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A  +A         ++M  +  + AV++YF++ RPQ ++ +    ++ ++ +GD 
Sbjct: 5   ISQAHAAGEAAPQGGG---MQMFIMLGMFAVIFYFMIYRPQAKRQKEHKNLMASMGKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++TA G+VGK+ +V ++   + +E+  N  V + + FVS V  K  
Sbjct: 62  VLTAGGLVGKITKVSEENDYIVIELNANNEVTIKKDFVSAVLPKGT 107


>gi|313673201|ref|YP_004051312.1| protein translocase subunit yajc [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939957|gb|ADR19149.1| protein translocase subunit yajC [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 108

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 4/107 (3%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF +  YA + A   +   +PL       ++  V+YFLLIRPQ+++ +   ++L +L+ G
Sbjct: 1   MFESLAYASNGA---SQGGNPLAGLIPLILIFGVFYFLLIRPQQKRQKEHMKLLESLKAG 57

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D ++T  GI G++ RVID    +VEIA+NV VR+ ++ V+   ++  
Sbjct: 58  DEVITTGGIYGRIDRVIDQNTFDVEIAKNVIVRMTKNAVAGKITQQT 104


>gi|258544913|ref|ZP_05705147.1| preprotein translocase, YajC subunit [Cardiobacterium hominis ATCC
           15826]
 gi|258519833|gb|EEV88692.1| preprotein translocase, YajC subunit [Cardiobacterium hominis ATCC
           15826]
          Length = 138

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/104 (27%), Positives = 60/104 (57%), Gaps = 5/104 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
               YAQ+   A   A+S      +  +L  V +F + RPQ+++++    ++ +L++GD 
Sbjct: 4   IQDAYAQAAPQAGGGASS----IIMMVLLIGVMWFFMFRPQQKKMKEHQLLISSLKKGDE 59

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T  GI+G+++ + D+  +++EIA+N  +RV R  V ++  K 
Sbjct: 60  VMTNGGIMGRIMDL-DNFAVDLEIAKNTVIRVQRGVVVQILPKG 102


>gi|183601034|ref|ZP_02962527.1| hypothetical protein PROSTU_04655 [Providencia stuartii ATCC 25827]
 gi|188019372|gb|EDU57412.1| hypothetical protein PROSTU_04655 [Providencia stuartii ATCC 25827]
          Length = 110

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 57/90 (63%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             +P  M  +  V A+++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V +V 
Sbjct: 17  QGNPYTMIIMLAVFALIFYFMILRPQQKRAKEHRKLMESITKGDEVLTTGGLIGRVTKVS 76

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D+  + +E++EN  V + R FV+ V  K  
Sbjct: 77  DNGYVVLELSENTEVTIKRDFVAAVLPKGT 106


>gi|28198111|ref|NP_778425.1| preprotein translocase subunit YajC [Xylella fastidiosa Temecula1]
 gi|28056171|gb|AAO28074.1| preprotein translocase YajC subunit [Xylella fastidiosa Temecula1]
          Length = 114

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
                AQS APA  S    L+M  L  +L  V YF +IRPQ ++ +    M+ +L  GD 
Sbjct: 6   IPVAQAQSAAPAGASPGGGLQMFFLPVILIAVMYFSIIRPQMKRQKEYKTMMDHLGCGDE 65

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++TA GI G VV VI D  + VEIAENVRVRV +S +++   K 
Sbjct: 66  VITAGGIAG-VVSVIGDEFVTVEIAENVRVRVQKSAIAKALPKG 108


>gi|71900798|ref|ZP_00682917.1| YajC [Xylella fastidiosa Ann-1]
 gi|182680739|ref|YP_001828899.1| preprotein translocase subunit YajC [Xylella fastidiosa M23]
 gi|71729419|gb|EAO31531.1| YajC [Xylella fastidiosa Ann-1]
 gi|182630849|gb|ACB91625.1| preprotein translocase, YajC subunit [Xylella fastidiosa M23]
          Length = 120

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
                AQS APA  S    L+M  L  +L  V YF +IRPQ ++ +    M+ +L  GD 
Sbjct: 12  IPVAQAQSAAPAGASPGGGLQMFFLPVILIAVMYFSIIRPQMKRQKEYKTMMDHLGCGDE 71

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++TA GI G VV VI D  + VEIAENVRVRV +S +++   K 
Sbjct: 72  VITAGGIAG-VVSVIGDEFVTVEIAENVRVRVQKSAIAKALPKG 114


>gi|42932|emb|CAA39633.1| unnamed protein product [Escherichia coli K-12]
          Length = 110

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V ++  + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAENGYIRIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|238897330|ref|YP_002923007.1| preprotein translocase, auxillary membrane component (General
           Secretory Pathway) [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465085|gb|ACQ66859.1| preprotein translocase, auxillary membrane component (General
           Secretory Pathway) [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 113

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 58/106 (54%), Gaps = 3/106 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +F+  +A +   +     +P  +  +  +  +++YF+++RPQ+++ +   +++ ++ +GD
Sbjct: 3   IFSQAFAST---SEAPQGNPYSLIIMLVIFGLIFYFMILRPQQKRTKDHKKLMDSISKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T  G+VG V +V +   + + + +   V + R FV+ V  K  
Sbjct: 60  EVLTTGGLVGHVSKVTETGYIVMSLNDTTEVTIKRDFVAAVLPKGT 105


>gi|85703423|ref|ZP_01034527.1| preprotein translocase, YajC subunit [Roseovarius sp. 217]
 gi|85672351|gb|EAQ27208.1| preprotein translocase, YajC subunit [Roseovarius sp. 217]
          Length = 93

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/87 (45%), Positives = 61/87 (70%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   ++  + YFLLIRPQ+++L+    M+  LRRGD +VT  G++GKV +V DD E
Sbjct: 4   FGQFIPLILIFAIMYFLLIRPQQKKLKEHKAMVEALRRGDQVVTQGGLIGKVSKVKDDSE 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +EVE+A+ V+VRVVR+ +++V SK+EP
Sbjct: 64  IEVELADGVKVRVVRATIAQVLSKTEP 90


>gi|295096810|emb|CBK85900.1| protein translocase subunit yajC [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 110

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMNSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V ++  + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|288940931|ref|YP_003443171.1| preprotein translocase subunit YajC [Allochromatium vinosum DSM
           180]
 gi|288896303|gb|ADC62139.1| preprotein translocase, YajC subunit [Allochromatium vinosum DSM
           180]
          Length = 111

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +   AQ +A A   A  P        + AVV+YFLLIRPQ ++ +   +M+  L +GD
Sbjct: 4   LISDALAQGEAVAPA-AGDPFMALLPLVLFAVVFYFLLIRPQAKRQKEHRKMIEALAKGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            I+T  G+ G++  + ++  L VE+A+ ++V++ RS V  V  K  
Sbjct: 63  EIITMGGMAGRIADLGENFAL-VEVADGMKVKIRRSAVESVLPKGT 107


>gi|156935044|ref|YP_001438960.1| preprotein translocase subunit YajC [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156533298|gb|ABU78124.1| hypothetical protein ESA_02895 [Cronobacter sakazakii ATCC BAA-894]
          Length = 110

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A   APA     SP+ +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD 
Sbjct: 5   ISDAVAAGGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMNSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V ++  + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|157961297|ref|YP_001501331.1| preprotein translocase subunit YajC [Shewanella pealeana ATCC
           700345]
 gi|167623486|ref|YP_001673780.1| preprotein translocase subunit YajC [Shewanella halifaxensis
           HAW-EB4]
 gi|157846297|gb|ABV86796.1| preprotein translocase, YajC subunit [Shewanella pealeana ATCC
           700345]
 gi|167353508|gb|ABZ76121.1| preprotein translocase, YajC subunit [Shewanella halifaxensis
           HAW-EB4]
          Length = 110

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA      +  A   +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD 
Sbjct: 3   ISNAYAADA--PVGGAGGTMELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLSKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T+ GI+GK+ ++ D+   + + I E   + + + +++ V  K 
Sbjct: 61  VLTSGGILGKIAKISDENDYVLLTINETSEITIKKDYIAAVLPKG 105


>gi|170726110|ref|YP_001760136.1| preprotein translocase subunit YajC [Shewanella woodyi ATCC 51908]
 gi|169811457|gb|ACA86041.1| preprotein translocase, YajC subunit [Shewanella woodyi ATCC 51908]
          Length = 110

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 59/106 (55%), Gaps = 3/106 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YA      ++ A   +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD
Sbjct: 2   LISNAYAADA--PVSGAGGTMELVFMLVIFGLIFYFMIFRPQSKRVKEHKSLMSSLGKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKS 105
            ++T+ GI+GK+ ++ D+   + + + E   + + + +++ V  K 
Sbjct: 60  EVLTSGGILGKIAKISDENDYVLLSLNETTEITIKKDYIAAVLPKG 105


>gi|254503221|ref|ZP_05115372.1| preprotein translocase, YajC subunit [Labrenzia alexandrii DFL-11]
 gi|222439292|gb|EEE45971.1| preprotein translocase, YajC subunit [Labrenzia alexandrii DFL-11]
          Length = 110

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 68/91 (74%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L     F  +  + YFL+IRPQRQ++++  E++ NLRRGD++VT  G++GKV +V+D
Sbjct: 16  PDFLMSMLPFVAIFAIMYFLIIRPQRQRMKQHQELVSNLRRGDTVVTTGGLIGKVSKVVD 75

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D E+++E++E V+VRVVRS V EV+SK+EPV
Sbjct: 76  DGEIQLELSEGVKVRVVRSMVQEVRSKTEPV 106


>gi|78186047|ref|YP_374090.1| hypothetical protein Plut_0157 [Chlorobium luteolum DSM 273]
 gi|78165949|gb|ABB23047.1| protein translocase subunit yajC [Chlorobium luteolum DSM 273]
          Length = 118

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 58/102 (56%), Gaps = 1/102 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +  T+   +       A +PL       ++ VV+YF +IRPQ+++ + R ++L +L+RGD
Sbjct: 4   LIQTILLFAPPTQGGPAPNPLVQLVPLVLIFVVFYFFMIRPQQKKQKDREKVLESLKRGD 63

Query: 61  SIVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEV 101
            +VT  GI G V  +  +   + V+++EN +++  RS V+ +
Sbjct: 64  RVVTIGGIHGTVAGIDTEKKTVLVQVSENTKIKFDRSAVANI 105


>gi|157376026|ref|YP_001474626.1| preprotein translocase subunit YajC [Shewanella sediminis HAW-EB3]
 gi|157318400|gb|ABV37498.1| preprotein translocase, YajC subunit [Shewanella sediminis HAW-EB3]
          Length = 110

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 60/106 (56%), Gaps = 3/106 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YA      +T A   +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD
Sbjct: 2   LISNAYAADA--PVTGAGGTMELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMGSLGKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKS 105
            ++T+ GI+GK+ ++ D+   + + I+E   + + + ++S V  K 
Sbjct: 60  EVLTSGGILGKIAKISDENDYVLLTISETTEITIKKDYISAVLPKG 105


>gi|15800134|ref|NP_286146.1| preprotein translocase subunit YajC [Escherichia coli O157:H7
           EDL933]
 gi|15829712|ref|NP_308485.1| preprotein translocase subunit YajC [Escherichia coli O157:H7 str.
           Sakai]
 gi|16128392|ref|NP_414941.1| SecYEG protein translocase auxillary subunit [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24111785|ref|NP_706295.1| preprotein translocase subunit YajC [Shigella flexneri 2a str. 301]
 gi|30061902|ref|NP_836073.1| preprotein translocase subunit YajC [Shigella flexneri 2a str.
           2457T]
 gi|74310976|ref|YP_309395.1| preprotein translocase subunit YajC [Shigella sonnei Ss046]
 gi|82542895|ref|YP_406842.1| preprotein translocase subunit YajC [Shigella boydii Sb227]
 gi|82775688|ref|YP_402035.1| preprotein translocase subunit YajC [Shigella dysenteriae Sd197]
 gi|89107277|ref|AP_001057.1| SecYEG protein translocase auxillary subunit [Escherichia coli str.
           K-12 substr. W3110]
 gi|110640668|ref|YP_668396.1| preprotein translocase subunit YajC [Escherichia coli 536]
 gi|110804429|ref|YP_687949.1| preprotein translocase subunit YajC [Shigella flexneri 5 str. 8401]
 gi|117622668|ref|YP_851581.1| preprotein translocase subunit YajC [Escherichia coli APEC O1]
 gi|157158712|ref|YP_001461588.1| preprotein translocase subunit YajC [Escherichia coli E24377A]
 gi|157159927|ref|YP_001457245.1| preprotein translocase subunit YajC [Escherichia coli HS]
 gi|161486298|ref|NP_752451.2| preprotein translocase subunit YajC [Escherichia coli CFT073]
 gi|162138481|ref|YP_539461.2| preprotein translocase subunit YajC [Escherichia coli UTI89]
 gi|168749863|ref|ZP_02774885.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|168756943|ref|ZP_02781950.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|168761607|ref|ZP_02786614.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768352|ref|ZP_02793359.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776293|ref|ZP_02801300.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783267|ref|ZP_02808274.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786248|ref|ZP_02811255.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|168800284|ref|ZP_02825291.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|170021221|ref|YP_001726175.1| preprotein translocase subunit YajC [Escherichia coli ATCC 8739]
 gi|170079993|ref|YP_001729313.1| SecYEG protein translocase auxillary subunit [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170683289|ref|YP_001742542.1| preprotein translocase subunit YajC [Escherichia coli SMS-3-5]
 gi|170767764|ref|ZP_02902217.1| preprotein translocase, YajC subunit [Escherichia albertii TW07627]
 gi|188496275|ref|ZP_03003545.1| preprotein translocase, YajC subunit [Escherichia coli 53638]
 gi|191166696|ref|ZP_03028523.1| preprotein translocase, YajC subunit [Escherichia coli B7A]
 gi|191173535|ref|ZP_03035062.1| preprotein translocase, YajC subunit [Escherichia coli F11]
 gi|193065152|ref|ZP_03046225.1| preprotein translocase, YajC subunit [Escherichia coli E22]
 gi|193068621|ref|ZP_03049582.1| preprotein translocase, YajC subunit [Escherichia coli E110019]
 gi|194428816|ref|ZP_03061351.1| preprotein translocase, YajC subunit [Escherichia coli B171]
 gi|194432632|ref|ZP_03064918.1| preprotein translocase, YajC subunit [Shigella dysenteriae 1012]
 gi|194438898|ref|ZP_03070983.1| preprotein translocase, YajC subunit [Escherichia coli 101-1]
 gi|195938530|ref|ZP_03083912.1| preprotein translocase subunit YajC [Escherichia coli O157:H7 str.
           EC4024]
 gi|208808119|ref|ZP_03250456.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816158|ref|ZP_03257337.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208823179|ref|ZP_03263497.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209395823|ref|YP_002269049.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209917619|ref|YP_002291703.1| preprotein translocase subunit YajC [Escherichia coli SE11]
 gi|215485488|ref|YP_002327919.1| preprotein translocase subunit YajC [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324522|ref|ZP_03440606.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218549933|ref|YP_002383724.1| preprotein translocase subunit YajC [Escherichia fergusonii ATCC
           35469]
 gi|218552970|ref|YP_002385883.1| preprotein translocase subunit YajC [Escherichia coli IAI1]
 gi|218557316|ref|YP_002390229.1| preprotein translocase subunit YajC [Escherichia coli S88]
 gi|218688270|ref|YP_002396482.1| preprotein translocase subunit YajC [Escherichia coli ED1a]
 gi|218693868|ref|YP_002401535.1| preprotein translocase subunit YajC [Escherichia coli 55989]
 gi|218698688|ref|YP_002406317.1| preprotein translocase subunit YajC [Escherichia coli IAI39]
 gi|218703689|ref|YP_002411208.1| preprotein translocase subunit YajC [Escherichia coli UMN026]
 gi|227884585|ref|ZP_04002390.1| preprotein translocase subunit YajC [Escherichia coli 83972]
 gi|238899695|ref|YP_002925491.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           BW2952]
 gi|253774608|ref|YP_003037439.1| preprotein translocase subunit YajC [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160473|ref|YP_003043581.1| preprotein translocase subunit YajC [Escherichia coli B str.
           REL606]
 gi|254791588|ref|YP_003076425.1| preprotein translocase subunit YajC [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020374|ref|ZP_05434239.1| preprotein translocase subunit YajC [Shigella sp. D9]
 gi|256023976|ref|ZP_05437841.1| preprotein translocase subunit YajC [Escherichia sp. 4_1_40B]
 gi|260842605|ref|YP_003220383.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O103:H2 str. 12009]
 gi|260853627|ref|YP_003227518.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O26:H11 str. 11368]
 gi|260866565|ref|YP_003232967.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O111:H- str. 11128]
 gi|261223884|ref|ZP_05938165.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256402|ref|ZP_05948935.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281311|ref|YP_003498129.1| hypothetical protein G2583_0516 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293403526|ref|ZP_06647617.1| UPF0092 membrane protein yajC [Escherichia coli FVEC1412]
 gi|293408553|ref|ZP_06652392.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293413661|ref|ZP_06656310.1| membrane protein yajC [Escherichia coli B185]
 gi|293418474|ref|ZP_06660909.1| UPF0092 membrane protein yajC [Escherichia coli B088]
 gi|297517230|ref|ZP_06935616.1| preprotein translocase subunit YajC [Escherichia coli OP50]
 gi|298379138|ref|ZP_06989019.1| membrane protein yajC [Escherichia coli FVEC1302]
 gi|300818270|ref|ZP_07098481.1| preprotein translocase, YajC subunit [Escherichia coli MS 107-1]
 gi|300820355|ref|ZP_07100507.1| preprotein translocase, YajC subunit [Escherichia coli MS 119-7]
 gi|300900473|ref|ZP_07118640.1| preprotein translocase, YajC subunit [Escherichia coli MS 198-1]
 gi|300903329|ref|ZP_07121257.1| preprotein translocase, YajC subunit [Escherichia coli MS 84-1]
 gi|300918214|ref|ZP_07134820.1| preprotein translocase, YajC subunit [Escherichia coli MS 115-1]
 gi|300924126|ref|ZP_07140118.1| preprotein translocase, YajC subunit [Escherichia coli MS 182-1]
 gi|300930299|ref|ZP_07145712.1| preprotein translocase, YajC subunit [Escherichia coli MS 187-1]
 gi|300947943|ref|ZP_07162090.1| preprotein translocase, YajC subunit [Escherichia coli MS 116-1]
 gi|300957970|ref|ZP_07170136.1| preprotein translocase, YajC subunit [Escherichia coli MS 175-1]
 gi|301049607|ref|ZP_07196558.1| preprotein translocase, YajC subunit [Escherichia coli MS 185-1]
 gi|301301554|ref|ZP_07207689.1| preprotein translocase, YajC subunit [Escherichia coli MS 124-1]
 gi|301330733|ref|ZP_07223335.1| preprotein translocase, YajC subunit [Escherichia coli MS 78-1]
 gi|301647327|ref|ZP_07247140.1| preprotein translocase, YajC subunit [Escherichia coli MS 146-1]
 gi|306813127|ref|ZP_07447320.1| preprotein translocase subunit YajC [Escherichia coli NC101]
 gi|307137049|ref|ZP_07496405.1| preprotein translocase subunit YajC [Escherichia coli H736]
 gi|307312218|ref|ZP_07591854.1| preprotein translocase, YajC subunit [Escherichia coli W]
 gi|309786994|ref|ZP_07681606.1| preprotein translocase, YajC subunit [Shigella dysenteriae 1617]
 gi|309794869|ref|ZP_07689290.1| preprotein translocase, YajC subunit [Escherichia coli MS 145-7]
 gi|312964571|ref|ZP_07778827.1| preprotein translocase, YajC subunit [Escherichia coli 2362-75]
 gi|312970501|ref|ZP_07784682.1| preprotein translocase, YajC subunit [Escherichia coli 1827-70]
 gi|331656461|ref|ZP_08357423.1| preprotein translocase, YajC subunit [Escherichia coli TA206]
 gi|331661782|ref|ZP_08362705.1| preprotein translocase, YajC subunit [Escherichia coli TA143]
 gi|331666756|ref|ZP_08367630.1| preprotein translocase, YajC subunit [Escherichia coli TA271]
 gi|331681800|ref|ZP_08382433.1| preprotein translocase, YajC subunit [Escherichia coli H299]
 gi|83287805|sp|P0ADZ9|YAJC_ECO57 RecName: Full=UPF0092 membrane protein yajC
 gi|83287806|sp|P0ADZ8|YAJC_ECOL6 RecName: Full=UPF0092 membrane protein yajC
 gi|83287807|sp|P0ADZ7|YAJC_ECOLI RecName: Full=UPF0092 membrane protein yajC
 gi|83287808|sp|P0AE00|YAJC_SHIFL RecName: Full=UPF0092 membrane protein yajC
 gi|12513257|gb|AAG54754.1|AE005220_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|147967|gb|AAA24668.1| ORF [Escherichia coli]
 gi|545174|gb|AAC60468.1| YajC [Escherichia coli]
 gi|599589|dbj|BAA05483.1| ORF [Shigella flexneri]
 gi|1773091|gb|AAB40163.1| hypothetical 11.9 kd protein [Escherichia coli]
 gi|1786608|gb|AAC73510.1| SecYEG protein translocase auxillary subunit [Escherichia coli str.
           K-12 substr. MG1655]
 gi|13359915|dbj|BAB33881.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24050572|gb|AAN42002.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30040146|gb|AAP15879.1| hypothetical protein S0352 [Shigella flexneri 2a str. 2457T]
 gi|73854453|gb|AAZ87160.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81239836|gb|ABB60546.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81244306|gb|ABB65014.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85674547|dbj|BAE76187.1| SecYEG protein translocase auxillary subunit [Escherichia coli str.
           K12 substr. W3110]
 gi|110342260|gb|ABG68497.1| probable transmembrane protein YajC [Escherichia coli 536]
 gi|110613977|gb|ABF02644.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115511792|gb|ABI99866.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157065607|gb|ABV04862.1| preprotein translocase, YajC subunit [Escherichia coli HS]
 gi|157080742|gb|ABV20450.1| preprotein translocase, YajC subunit [Escherichia coli E24377A]
 gi|169756149|gb|ACA78848.1| preprotein translocase, YajC subunit [Escherichia coli ATCC 8739]
 gi|169887828|gb|ACB01535.1| SecYEG protein translocase auxillary subunit [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170123252|gb|EDS92183.1| preprotein translocase, YajC subunit [Escherichia albertii TW07627]
 gi|170521007|gb|ACB19185.1| preprotein translocase, YajC subunit [Escherichia coli SMS-3-5]
 gi|187768268|gb|EDU32112.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4196]
 gi|188015895|gb|EDU54017.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4113]
 gi|188491474|gb|EDU66577.1| preprotein translocase, YajC subunit [Escherichia coli 53638]
 gi|188999365|gb|EDU68351.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4076]
 gi|189356026|gb|EDU74445.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362468|gb|EDU80887.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367973|gb|EDU86389.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373656|gb|EDU92072.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC869]
 gi|189377408|gb|EDU95824.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC508]
 gi|190903207|gb|EDV62929.1| preprotein translocase, YajC subunit [Escherichia coli B7A]
 gi|190906244|gb|EDV65856.1| preprotein translocase, YajC subunit [Escherichia coli F11]
 gi|192927126|gb|EDV81747.1| preprotein translocase, YajC subunit [Escherichia coli E22]
 gi|192957984|gb|EDV88426.1| preprotein translocase, YajC subunit [Escherichia coli E110019]
 gi|194413119|gb|EDX29406.1| preprotein translocase, YajC subunit [Escherichia coli B171]
 gi|194419193|gb|EDX35276.1| preprotein translocase, YajC subunit [Shigella dysenteriae 1012]
 gi|194422192|gb|EDX38194.1| preprotein translocase, YajC subunit [Escherichia coli 101-1]
 gi|208727920|gb|EDZ77521.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4206]
 gi|208732806|gb|EDZ81494.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4045]
 gi|208737372|gb|EDZ85056.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157223|gb|ACI34656.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           EC4115]
 gi|209744154|gb|ACI70384.1| hypothetical protein ECs0458 [Escherichia coli]
 gi|209744156|gb|ACI70385.1| hypothetical protein ECs0458 [Escherichia coli]
 gi|209744158|gb|ACI70386.1| hypothetical protein ECs0458 [Escherichia coli]
 gi|209744160|gb|ACI70387.1| hypothetical protein ECs0458 [Escherichia coli]
 gi|209744162|gb|ACI70388.1| hypothetical protein ECs0458 [Escherichia coli]
 gi|209910878|dbj|BAG75952.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215263560|emb|CAS07890.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217320743|gb|EEC29167.1| preprotein translocase, YajC subunit [Escherichia coli O157:H7 str.
           TW14588]
 gi|218350600|emb|CAU96290.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           55989]
 gi|218357474|emb|CAQ90113.1| SecYEG protein translocase auxillary subunit [Escherichia
           fergusonii ATCC 35469]
 gi|218359738|emb|CAQ97279.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           IAI1]
 gi|218364085|emb|CAR01750.1| SecYEG protein translocase auxillary subunit [Escherichia coli S88]
 gi|218368674|emb|CAR16414.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           IAI39]
 gi|218425834|emb|CAR06640.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           ED1a]
 gi|218430786|emb|CAR11660.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           UMN026]
 gi|222032202|emb|CAP74941.1| UPF0092 membrane protein yajC [Escherichia coli LF82]
 gi|227838671|gb|EEJ49137.1| preprotein translocase subunit YajC [Escherichia coli 83972]
 gi|238863513|gb|ACR65511.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           BW2952]
 gi|242376185|emb|CAQ30876.1| yajC, subunit of SecD-SecF-YajC-YidC Secretion Complex and Sec
           Protein Secretion Complex [Escherichia coli BL21(DE3)]
 gi|253325652|gb|ACT30254.1| preprotein translocase, YajC subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972374|gb|ACT38045.1| preprotein translocase subunit YajC [Escherichia coli B str.
           REL606]
 gi|253976584|gb|ACT42254.1| preprotein translocase subunit YajC [Escherichia coli BL21(DE3)]
 gi|254590988|gb|ACT70349.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O157:H7 str. TW14359]
 gi|257752276|dbj|BAI23778.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O26:H11 str. 11368]
 gi|257757752|dbj|BAI29249.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O103:H2 str. 12009]
 gi|257762921|dbj|BAI34416.1| SecYEG protein translocase auxillary subunit [Escherichia coli
           O111:H- str. 11128]
 gi|260450406|gb|ACX40828.1| preprotein translocase, YajC subunit [Escherichia coli DH1]
 gi|281177577|dbj|BAI53907.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|281599739|gb|ADA72723.1| membrane protein yajC [Shigella flexneri 2002017]
 gi|284920214|emb|CBG33273.1| putative preprotein translocase subunit [Escherichia coli 042]
 gi|290761184|gb|ADD55145.1| UPF0092 membrane protein yajC [Escherichia coli O55:H7 str. CB9615]
 gi|291325002|gb|EFE64417.1| UPF0092 membrane protein yajC [Escherichia coli B088]
 gi|291429379|gb|EFF02399.1| UPF0092 membrane protein yajC [Escherichia coli FVEC1412]
 gi|291433719|gb|EFF06692.1| membrane protein yajC [Escherichia coli B185]
 gi|291471731|gb|EFF14214.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294492120|gb|ADE90876.1| preprotein translocase, YajC subunit [Escherichia coli IHE3034]
 gi|298280251|gb|EFI21755.1| membrane protein yajC [Escherichia coli FVEC1302]
 gi|300298600|gb|EFJ54985.1| preprotein translocase, YajC subunit [Escherichia coli MS 185-1]
 gi|300315344|gb|EFJ65128.1| preprotein translocase, YajC subunit [Escherichia coli MS 175-1]
 gi|300355954|gb|EFJ71824.1| preprotein translocase, YajC subunit [Escherichia coli MS 198-1]
 gi|300404624|gb|EFJ88162.1| preprotein translocase, YajC subunit [Escherichia coli MS 84-1]
 gi|300414599|gb|EFJ97909.1| preprotein translocase, YajC subunit [Escherichia coli MS 115-1]
 gi|300419579|gb|EFK02890.1| preprotein translocase, YajC subunit [Escherichia coli MS 182-1]
 gi|300452495|gb|EFK16115.1| preprotein translocase, YajC subunit [Escherichia coli MS 116-1]
 gi|300461871|gb|EFK25364.1| preprotein translocase, YajC subunit [Escherichia coli MS 187-1]
 gi|300527140|gb|EFK48209.1| preprotein translocase, YajC subunit [Escherichia coli MS 119-7]
 gi|300529161|gb|EFK50223.1| preprotein translocase, YajC subunit [Escherichia coli MS 107-1]
 gi|300843051|gb|EFK70811.1| preprotein translocase, YajC subunit [Escherichia coli MS 124-1]
 gi|300843394|gb|EFK71154.1| preprotein translocase, YajC subunit [Escherichia coli MS 78-1]
 gi|301074523|gb|EFK89329.1| preprotein translocase, YajC subunit [Escherichia coli MS 146-1]
 gi|305853890|gb|EFM54329.1| preprotein translocase subunit YajC [Escherichia coli NC101]
 gi|306907720|gb|EFN38222.1| preprotein translocase, YajC subunit [Escherichia coli W]
 gi|307552312|gb|ADN45087.1| SecYEG protein translocase auxillary subunit [Escherichia coli ABU
           83972]
 gi|307628124|gb|ADN72428.1| preprotein translocase subunit YajC [Escherichia coli UM146]
 gi|308121522|gb|EFO58784.1| preprotein translocase, YajC subunit [Escherichia coli MS 145-7]
 gi|308924572|gb|EFP70067.1| preprotein translocase, YajC subunit [Shigella dysenteriae 1617]
 gi|309700669|emb|CBI99965.1| putative preprotein translocase subunit [Escherichia coli ETEC
           H10407]
 gi|310337150|gb|EFQ02288.1| preprotein translocase, YajC subunit [Escherichia coli 1827-70]
 gi|312290805|gb|EFR18682.1| preprotein translocase, YajC subunit [Escherichia coli 2362-75]
 gi|312944984|gb|ADR25811.1| preprotein translocase subunit YajC [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313646976|gb|EFS11433.1| preprotein translocase, YajC subunit [Shigella flexneri 2a str.
           2457T]
 gi|315059684|gb|ADT74011.1| SecYEG protein translocase auxillary subunit [Escherichia coli W]
 gi|315135089|dbj|BAJ42248.1| preprotein translocase subunit YajC [Escherichia coli DH1]
 gi|315256231|gb|EFU36199.1| preprotein translocase, YajC subunit [Escherichia coli MS 85-1]
 gi|315616653|gb|EFU97270.1| preprotein translocase, YajC subunit [Escherichia coli 3431]
 gi|320173775|gb|EFW48958.1| Preprotein translocase subunit YajC [Shigella dysenteriae CDC
           74-1112]
 gi|320181611|gb|EFW56526.1| Preprotein translocase subunit YajC [Shigella boydii ATCC 9905]
 gi|320186036|gb|EFW60781.1| Preprotein translocase subunit YajC [Shigella flexneri CDC 796-83]
 gi|320192820|gb|EFW67460.1| Preprotein translocase subunit YajC [Escherichia coli O157:H7 str.
           EC1212]
 gi|320197157|gb|EFW71774.1| Preprotein translocase subunit YajC [Escherichia coli WV_060327]
 gi|320201648|gb|EFW76224.1| Preprotein translocase subunit YajC [Escherichia coli EC4100B]
 gi|320638396|gb|EFX08110.1| preprotein translocase subunit YajC [Escherichia coli O157:H7 str.
           G5101]
 gi|320643776|gb|EFX12899.1| preprotein translocase subunit YajC [Escherichia coli O157:H- str.
           493-89]
 gi|320649127|gb|EFX17705.1| preprotein translocase subunit YajC [Escherichia coli O157:H- str.
           H 2687]
 gi|320656020|gb|EFX23936.1| preprotein translocase subunit YajC [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661170|gb|EFX28601.1| preprotein translocase subunit YajC [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320665146|gb|EFX32239.1| preprotein translocase subunit YajC [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323152125|gb|EFZ38418.1| preprotein translocase, YajC subunit [Escherichia coli EPECa14]
 gi|323160486|gb|EFZ46434.1| preprotein translocase, YajC subunit [Escherichia coli E128010]
 gi|323164198|gb|EFZ50005.1| preprotein translocase, YajC subunit [Shigella sonnei 53G]
 gi|323170488|gb|EFZ56138.1| preprotein translocase, YajC subunit [Escherichia coli LT-68]
 gi|323178330|gb|EFZ63908.1| preprotein translocase, YajC subunit [Escherichia coli 1180]
 gi|323184767|gb|EFZ70138.1| preprotein translocase, YajC subunit [Escherichia coli 1357]
 gi|323191325|gb|EFZ76588.1| preprotein translocase, YajC subunit [Escherichia coli RN587/1]
 gi|323379750|gb|ADX52018.1| preprotein translocase, YajC subunit [Escherichia coli KO11]
 gi|323938592|gb|EGB34841.1| preprotein translocase [Escherichia coli E1520]
 gi|323943213|gb|EGB39369.1| preprotein translocase [Escherichia coli E482]
 gi|323945308|gb|EGB41364.1| preprotein translocase [Escherichia coli H120]
 gi|323952981|gb|EGB48849.1| preprotein translocase [Escherichia coli H252]
 gi|323958600|gb|EGB54303.1| preprotein translocase [Escherichia coli H263]
 gi|323963393|gb|EGB58955.1| preprotein translocase [Escherichia coli H489]
 gi|323965359|gb|EGB60817.1| preprotein translocase [Escherichia coli M863]
 gi|323972257|gb|EGB67467.1| preprotein translocase [Escherichia coli TA007]
 gi|323976112|gb|EGB71205.1| preprotein translocase [Escherichia coli TW10509]
 gi|324010084|gb|EGB79303.1| preprotein translocase, YajC subunit [Escherichia coli MS 57-2]
 gi|324114626|gb|EGC08594.1| preprotein translocase [Escherichia fergusonii B253]
 gi|324116891|gb|EGC10804.1| preprotein translocase [Escherichia coli E1167]
 gi|325498310|gb|EGC96169.1| preprotein translocase subunit YajC [Escherichia fergusonii ECD227]
 gi|326341167|gb|EGD64959.1| Preprotein translocase subunit YajC [Escherichia coli O157:H7 str.
           1044]
 gi|326346057|gb|EGD69796.1| Preprotein translocase subunit YajC [Escherichia coli O157:H7 str.
           1125]
 gi|327254725|gb|EGE66341.1| preprotein translocase, YajC subunit [Escherichia coli STEC_7v]
 gi|330910201|gb|EGH38711.1| preprotein translocase subunit YajC [Escherichia coli AA86]
 gi|331054709|gb|EGI26718.1| preprotein translocase, YajC subunit [Escherichia coli TA206]
 gi|331060204|gb|EGI32168.1| preprotein translocase, YajC subunit [Escherichia coli TA143]
 gi|331065980|gb|EGI37864.1| preprotein translocase, YajC subunit [Escherichia coli TA271]
 gi|331081002|gb|EGI52167.1| preprotein translocase, YajC subunit [Escherichia coli H299]
 gi|332085870|gb|EGI91034.1| preprotein translocase, YajC subunit [Shigella dysenteriae 155-74]
 gi|332094557|gb|EGI99603.1| preprotein translocase, YajC subunit [Shigella boydii 5216-82]
 gi|332098678|gb|EGJ03644.1| preprotein translocase, YajC subunit [Shigella boydii 3594-74]
 gi|332341770|gb|AEE55104.1| preprotein translocase YajC [Escherichia coli UMNK88]
 gi|332760686|gb|EGJ90974.1| preprotein translocase, YajC subunit [Shigella flexneri 4343-70]
 gi|332764284|gb|EGJ94520.1| preprotein translocase, YajC subunit [Shigella flexneri K-671]
 gi|332768512|gb|EGJ98695.1| preprotein translocase, YajC subunit [Shigella flexneri 2930-71]
 gi|333008076|gb|EGK27552.1| preprotein translocase, YajC subunit [Shigella flexneri K-218]
 gi|333008602|gb|EGK28070.1| preprotein translocase, YajC subunit [Shigella flexneri VA-6]
 gi|333010848|gb|EGK30274.1| preprotein translocase, YajC subunit [Shigella flexneri K-272]
 gi|333021347|gb|EGK40600.1| preprotein translocase, YajC subunit [Shigella flexneri K-227]
 gi|333022007|gb|EGK41252.1| preprotein translocase, YajC subunit [Shigella flexneri K-304]
 gi|740399|prf||2005253A yacJ protein
          Length = 110

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V ++  + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|224369814|ref|YP_002603978.1| putative preprotein translocase, subunit YajC [Desulfobacterium
           autotrophicum HRM2]
 gi|223692531|gb|ACN15814.1| putative preprotein translocase, subunit YajC [Desulfobacterium
           autotrophicum HRM2]
          Length = 115

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M  T +A   + A               ++ V++YFLLIRPQ+++ +    M+ +L++GD
Sbjct: 1   MINTAFAMGQSGAQGGQAGGFTAFVPLILMFVIFYFLLIRPQQKKAKEHQNMINSLKKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            ++T+ GI G +V + D+  + +EI++NV++++ R  V      S P
Sbjct: 61  RVITSGGIHGTIVSL-DETTINLEISDNVKIKINRGNVGTALQGSTP 106


>gi|83952733|ref|ZP_00961463.1| preprotein translocase, YajC subunit [Roseovarius nubinhibens ISM]
 gi|83835868|gb|EAP75167.1| preprotein translocase, YajC subunit [Roseovarius nubinhibens ISM]
          Length = 95

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/91 (46%), Positives = 62/91 (68%), Gaps = 1/91 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             + L       ++  + YFLLIRPQ+++++    M+  LR+GD +VT  G++GKV RV 
Sbjct: 3   GGNALAQFLPLILIFAIMYFLLIRPQQKKVKEHRAMVEALRKGDRVVTQGGLIGKVSRVQ 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            D ELEVE+A NV+VRV+R  +SEV+SK+EP
Sbjct: 63  -DGELEVELAPNVKVRVLRHAISEVRSKTEP 92


>gi|167627738|ref|YP_001678238.1| preprotein translocase family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|241668306|ref|ZP_04755884.1| preprotein translocase family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254876839|ref|ZP_05249549.1| preprotein translocase subunit yajC [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|167597739|gb|ABZ87737.1| preprotein translocase family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|254842860|gb|EET21274.1| preprotein translocase subunit yajC [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 118

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 63/103 (61%), Gaps = 4/103 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           +T +A+    A     SP+    +  V   +++FLLIRPQ+++ +   +ML  L +GD +
Sbjct: 16  STSFAEGAEQAA---GSPISSILMLVVFFAIFWFLLIRPQQKKNKELRKMLSELSKGDEV 72

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           VT  G++GK+ ++ D+  +++EIAENV V++ R+ V+ +  K 
Sbjct: 73  VTNGGMIGKIAKI-DESFVDLEIAENVVVKIQRNAVANILPKG 114


>gi|301025761|ref|ZP_07189275.1| preprotein translocase, YajC subunit [Escherichia coli MS 196-1]
 gi|299879988|gb|EFI88199.1| preprotein translocase, YajC subunit [Escherichia coli MS 196-1]
          Length = 110

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +V+YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLVFYFMILRPQQKRTKEHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V ++  + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|259419328|ref|ZP_05743245.1| preprotein translocase, YajC subunit [Silicibacter sp. TrichCH4B]
 gi|259345550|gb|EEW57404.1| preprotein translocase, YajC subunit [Silicibacter sp. TrichCH4B]
          Length = 94

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 63/90 (70%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + YFLLIRPQ++++++   M+  LRRGD ++T  G++GKV +V +
Sbjct: 3   GGAIAQFLPLILIFAIMYFLLIRPQQKKMKQHQNMVEALRRGDQVITQGGVIGKVSKVKE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D ELEVEIAE V+VRVV+S +++V +K+EP
Sbjct: 63  DGELEVEIAEGVKVRVVKSTIAQVLNKTEP 92


>gi|114320373|ref|YP_742056.1| protein translocase subunit yajC [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226767|gb|ABI56566.1| protein translocase subunit yajC [Alkalilimnicola ehrlichii MLHE-1]
          Length = 168

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 58/105 (55%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +T  AQ          +PL       ++  +++FLLIRPQ+++ +   +M+  L RGD 
Sbjct: 5   ISTAMAQ----GGGEQGNPLFGIIFLVLMMAIFWFLLIRPQQKRQKAHQKMVTELSRGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G++G+V  V +   + +E++++ +VRV ++ V+ V  K  
Sbjct: 61  VVTNGGVLGRVTAVGE-TFITLEVSKSQQVRVQKNAVANVMPKGT 104


>gi|260776670|ref|ZP_05885565.1| preprotein translocase subunit YajC [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607893|gb|EEX34158.1| preprotein translocase subunit YajC [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 60/107 (56%), Gaps = 5/107 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YA   APA        EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD
Sbjct: 2   IISPAYAAESAPAGGG----FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKSLMSSMGKGD 57

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+VGK+ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 58  EVLTSGGLVGKITKIAEDNDYISIELNTNNEVVIKKDFVTAVLPKGT 104


>gi|238893343|ref|YP_002918077.1| preprotein translocase subunit YajC [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238545659|dbj|BAH62010.1| preprotein translocase auxillary subunit [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 120

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD 
Sbjct: 15  ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMNSIAKGDE 71

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 72  VLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPKGT 116


>gi|212634514|ref|YP_002311039.1| preprotein translocase subunit YajC [Shewanella piezotolerans WP3]
 gi|212555998|gb|ACJ28452.1| Preprotein translocase, YajC subunit [Shewanella piezotolerans WP3]
          Length = 110

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA      +  A   +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD 
Sbjct: 3   ISNAYAADA--PVGGAGGTMELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLSKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T+ GI+GK+ ++ D+   + + I E   + + + +++ V  K 
Sbjct: 61  VLTSGGILGKIAKISDENDYVLLAINETSEITIKKDYIAAVLPKG 105


>gi|260596777|ref|YP_003209348.1| preprotein translocase subunit YajC [Cronobacter turicensis z3032]
 gi|260215954|emb|CBA28571.1| UPF0092 membrane protein yajC [Cronobacter turicensis z3032]
          Length = 110

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A   APA     SP+ +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD 
Sbjct: 5   ISDAVAAGGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMSSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V ++  + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|78188091|ref|YP_378429.1| hypothetical protein Cag_0108 [Chlorobium chlorochromatii CaD3]
 gi|78170290|gb|ABB27386.1| protein translocase subunit yajC [Chlorobium chlorochromatii CaD3]
          Length = 118

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +  ++   +   A     +P        ++ VV+YF +IRPQ+++ + R   L +L+RGD
Sbjct: 4   LILSLLLFAPPAAGQGNPNPFIQLVPLVLIFVVFYFFMIRPQQKKQKERETTLDSLKRGD 63

Query: 61  SIVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT  G+ G V  +  +   + V++++N +++  R+ ++ +  +  
Sbjct: 64  HVVTIGGVHGTVAGIDTEKKTVLVQVSDNTKIKFDRTAIATIDKQET 110


>gi|163736766|ref|ZP_02144185.1| preprotein translocase, YajC subunit [Phaeobacter gallaeciensis
           BS107]
 gi|161390636|gb|EDQ14986.1| preprotein translocase, YajC subunit [Phaeobacter gallaeciensis
           BS107]
          Length = 94

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/90 (45%), Positives = 62/90 (68%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++  + YFLLIRPQ+++L+    M+  LRRGD +VT  GI+GKV +V D
Sbjct: 3   GGALAQFLPLILIFGIMYFLLIRPQQKKLKTHQSMVEALRRGDQVVTQGGIIGKVAKVKD 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVEIAE V++RV++S +++V +K+EP
Sbjct: 63  DGEIEVEIAEGVKIRVIKSTIAQVLNKTEP 92


>gi|316934005|ref|YP_004108987.1| preprotein translocase subunit YajC [Rhodopseudomonas palustris
           DX-1]
 gi|315601719|gb|ADU44254.1| preprotein translocase, YajC subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 145

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 47/108 (43%), Positives = 73/108 (67%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF T      A A   A S L     F ++ V+ YFL++RPQ+++++  AEM++N+RRGD
Sbjct: 1   MFVTPAYAQAAAAGGDANSMLMSLLPFALIFVIMYFLILRPQQRKVKEHAEMVKNIRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +I+T+ G+VGKV +VIDD  +E E+A+ +R R +R  ++ V+SK EPV
Sbjct: 61  TIITSGGLVGKVTKVIDDDTVEFEVADGIRARQMRQMITGVRSKGEPV 108


>gi|119897196|ref|YP_932409.1| preprotein translocase subunit YajC [Azoarcus sp. BH72]
 gi|119669609|emb|CAL93522.1| probable preprotein translocase subunit YajC [Azoarcus sp. BH72]
          Length = 109

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YAQ+ A    +    L       ++ VV YFL+IRPQ ++ +    M+  L +GD
Sbjct: 3   LISNAYAQAAASQDPTGG--LMGMLPLILMFVVLYFLMIRPQMKRAKEHKSMVEALAKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT  GI G+V  + ++  + +E+A+   + V +  V+ V  K  
Sbjct: 61  EVVTQGGIAGRVAEIGENF-IHLEVADKTNIVVQKQAVATVLPKGT 105


>gi|157146977|ref|YP_001454296.1| preprotein translocase subunit YajC [Citrobacter koseri ATCC
           BAA-895]
 gi|157084182|gb|ABV13860.1| hypothetical protein CKO_02754 [Citrobacter koseri ATCC BAA-895]
          Length = 110

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMSSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAESGYIVIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|86138470|ref|ZP_01057044.1| preprotein translocase, YajC subunit [Roseobacter sp. MED193]
 gi|85824995|gb|EAQ45196.1| preprotein translocase, YajC subunit [Roseobacter sp. MED193]
          Length = 92

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 64/90 (71%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            + +       ++  + YFLLIRPQ+++++    M+ N+RRGD IVT  G++GK+ +V D
Sbjct: 1   MNQIGQFLPLILIFAIMYFLLIRPQQKKMKEHQTMVSNVRRGDQIVTQGGLIGKIAKVKD 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVE+AE V+VRVV+S +++V +K+EP
Sbjct: 61  DNEVEVELAEGVKVRVVKSTIAQVLTKTEP 90


>gi|308185878|ref|YP_003930009.1| UPF0092 membrane protein yajC [Pantoea vagans C9-1]
 gi|308056388|gb|ADO08560.1| UPF0092 membrane protein yajC [Pantoea vagans C9-1]
          Length = 110

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP   S  SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAAAGAP---SQGSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T+ G+VG+V +V D   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTSGGLVGRVTKVSDTGYVAIALNDTNEVVIKRDFVAAVLPKGT 106


>gi|21957735|gb|AAM84573.1|AE013703_3 hypothetical protein y0992 [Yersinia pestis KIM 10]
 gi|45435447|gb|AAS61006.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
          Length = 133

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 55/100 (55%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A + A A     S   M  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T+ 
Sbjct: 30  AVASAGAPAQGNSMTSMLIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDEVLTSG 89

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           G +G+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 90  GFIGRVTKVAETGYVVIALNDTTEVMIKRDFVAAVLPKGT 129


>gi|304395470|ref|ZP_07377353.1| preprotein translocase, YajC subunit [Pantoea sp. aB]
 gi|304356764|gb|EFM21128.1| preprotein translocase, YajC subunit [Pantoea sp. aB]
          Length = 110

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP   S  SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAAAGAP---SQGSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T+ G+VG+V +V D   + + + +   V V R FV+ V  K  
Sbjct: 62  VLTSGGLVGRVTKVSDTGYVAIALNDTNEVVVKRDFVAAVLPKGT 106


>gi|308050486|ref|YP_003914052.1| protein translocase subunit yajC [Ferrimonas balearica DSM 9799]
 gi|307632676|gb|ADN76978.1| protein translocase subunit yajC [Ferrimonas balearica DSM 9799]
          Length = 108

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
               YA + AP        +EM  +  V  +++YF+++RPQ ++++    ++ +L +GD 
Sbjct: 3   IANAYANTGAPQGGG----MEMVIMLAVFGLIFYFMILRPQNKRVKEHKNLVESLAKGDE 58

Query: 62  IVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T  G+VGK+V+V  DD  L + + EN  V + + F++ V  K 
Sbjct: 59  VLTNGGLVGKIVKVTADDDYLVLALGENTEVTIKKDFITAVLPKG 103


>gi|49475357|ref|YP_033398.1| hypothetical protein BH05640 [Bartonella henselae str. Houston-1]
 gi|19526704|gb|AAL89762.1|AF484425_3 YajC [Bartonella henselae str. Houston-1]
 gi|49238163|emb|CAF27372.1| Hypothetical protein BH05640 [Bartonella henselae str. Houston-1]
          Length = 148

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ         +  L     F ++  + YF +IRPQR Q+++R EML  +RRGD+
Sbjct: 3   ITNAYAQVAGGVSNGPS--LVTFVPFILIFGIMYFFIIRPQRAQMKKRQEMLNAVRRGDT 60

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           ++T  G++GKV +V D+  ELEVEI + +R+RV+RS +S+V+ K EP+
Sbjct: 61  VITGGGVIGKVTKVYDESGELEVEICDGMRIRVIRSTLSDVRVKGEPI 108


>gi|152968931|ref|YP_001334040.1| preprotein translocase subunit YajC [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206578929|ref|YP_002240126.1| preprotein translocase, YajC subunit [Klebsiella pneumoniae 342]
 gi|262042428|ref|ZP_06015588.1| preprotein translocase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936875|ref|YP_003440934.1| preprotein translocase, YajC subunit [Klebsiella variicola At-22]
 gi|290510069|ref|ZP_06549439.1| preprotein translocase YajC subunit [Klebsiella sp. 1_1_55]
 gi|330006901|ref|ZP_08305773.1| preprotein translocase, YajC subunit [Klebsiella sp. MS 92-3]
 gi|150953780|gb|ABR75810.1| preprotein translocase subunit YajC [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206567987|gb|ACI09763.1| preprotein translocase, YajC subunit [Klebsiella pneumoniae 342]
 gi|259040203|gb|EEW41314.1| preprotein translocase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891584|gb|ADC59902.1| preprotein translocase, YajC subunit [Klebsiella variicola At-22]
 gi|289776785|gb|EFD84783.1| preprotein translocase YajC subunit [Klebsiella sp. 1_1_55]
 gi|328535655|gb|EGF62104.1| preprotein translocase, YajC subunit [Klebsiella sp. MS 92-3]
          Length = 110

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMNSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|312171542|emb|CBX79800.1| UPF0092 membrane protein yajC [Erwinia amylovora ATCC BAA-2158]
          Length = 109

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 57/98 (58%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           + A A  S +SP  M  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+
Sbjct: 8   AVAAAAPSQSSPYSMVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIAKGDEVLTTGGL 67

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           VG+V +V D   + + + +   V V R FV+ V  K  
Sbjct: 68  VGRVTKVADTGYVAIALNDTTEVVVKRDFVAAVLPKGT 105


>gi|237730382|ref|ZP_04560863.1| preprotein translocase subunit YajC [Citrobacter sp. 30_2]
 gi|283834275|ref|ZP_06354016.1| preprotein translocase, YajC subunit [Citrobacter youngae ATCC
           29220]
 gi|226905921|gb|EEH91839.1| preprotein translocase subunit YajC [Citrobacter sp. 30_2]
 gi|291069799|gb|EFE07908.1| preprotein translocase, YajC subunit [Citrobacter youngae ATCC
           29220]
          Length = 110

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMNSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAESGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|292487439|ref|YP_003530311.1| hypothetical protein EAMY_0953 [Erwinia amylovora CFBP1430]
 gi|292898681|ref|YP_003538050.1| preprotein translocase subunit [Erwinia amylovora ATCC 49946]
 gi|291198529|emb|CBJ45637.1| preprotein translocase subunit [Erwinia amylovora ATCC 49946]
 gi|291552858|emb|CBA19903.1| UPF0092 membrane protein yajC [Erwinia amylovora CFBP1430]
          Length = 109

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 57/98 (58%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           + A A  S +SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+
Sbjct: 8   AVAAAAPSQSSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIAKGDEVLTTGGL 67

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           VG+V +V D   + + + +   V V R FV+ V  K  
Sbjct: 68  VGRVTKVADTGYVAIALNDTTEVVVKRDFVAAVLPKGT 105


>gi|90415879|ref|ZP_01223812.1| preprotein translocase, YajC subunit [marine gamma proteobacterium
           HTCC2207]
 gi|90332253|gb|EAS47450.1| preprotein translocase, YajC subunit [marine gamma proteobacterium
           HTCC2207]
          Length = 109

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF    AQ+   A            +F  L +  Y  +IRPQR++ +   +++  L +GD
Sbjct: 1   MFFISSAQAQTSAPAGDPGITGSLIMFGGLFIFMYLFIIRPQRKRQKEHTDLITGLSKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +   +GI+GKVV++ +   + VE+ + + ++  +S V  V  K  
Sbjct: 61  EVTMTSGILGKVVKL-EGEYVVVEVNDKLELKFQKSAVHAVLPKGT 105


>gi|163743215|ref|ZP_02150597.1| preprotein translocase, YajC subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161383632|gb|EDQ08019.1| preprotein translocase, YajC subunit [Phaeobacter gallaeciensis
           2.10]
          Length = 94

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 62/90 (68%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++  + YFLLIRPQ+++L+    M+  LRRGD +VT  GI+GKV +V +
Sbjct: 3   GGALAQFLPLILIFGIMYFLLIRPQQKKLKTHQSMVEALRRGDQVVTQGGIIGKVAKVKE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVEIAE V++RV++S +++V +K+EP
Sbjct: 63  DGEIEVEIAEGVKIRVIKSTIAQVLNKTEP 92


>gi|71276373|ref|ZP_00652650.1| YajC [Xylella fastidiosa Dixon]
 gi|71898644|ref|ZP_00680814.1| YajC [Xylella fastidiosa Ann-1]
 gi|170729422|ref|YP_001774855.1| preprotein translocase subunit YajC [Xylella fastidiosa M12]
 gi|71162835|gb|EAO12560.1| YajC [Xylella fastidiosa Dixon]
 gi|71731591|gb|EAO33652.1| YajC [Xylella fastidiosa Ann-1]
 gi|167964215|gb|ACA11225.1| preprotein translocase YajC subunit [Xylella fastidiosa M12]
          Length = 120

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
                AQS APA  S    L+M  L  +L  V YF +IRPQ ++ +    M+ +L  GD 
Sbjct: 12  IPVAQAQSAAPAGVSPGGGLQMFFLPVILIAVMYFSIIRPQMKRQKEYKTMMDHLGCGDE 71

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++TA GI G VV VI D  + VEIAENVRVRV +S +++   K 
Sbjct: 72  VITAGGIAG-VVSVIGDEFVTVEIAENVRVRVQKSAIAKALPKG 114


>gi|226329114|ref|ZP_03804632.1| hypothetical protein PROPEN_03017 [Proteus penneri ATCC 35198]
 gi|225202300|gb|EEG84654.1| hypothetical protein PROPEN_03017 [Proteus penneri ATCC 35198]
          Length = 111

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 57/100 (57%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A + A       S + +  +  +  +++YF+++RPQ+++ +   +++ ++ +GD ++T  
Sbjct: 8   AVASAGQAAPEASFMSILPMLVIFILIFYFMILRPQQKRTKEHRKLMDSIGKGDEVLTTG 67

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           G++G+VV+V D+  + V + E   V + R FV+ V  K  
Sbjct: 68  GLIGRVVKVSDNGYIVVALNETTEVTIKRDFVAAVLPKGT 107


>gi|145219038|ref|YP_001129747.1| protein translocase subunit yajC [Prosthecochloris vibrioformis DSM
           265]
 gi|145205202|gb|ABP36245.1| protein translocase subunit yajC [Chlorobium phaeovibrioides DSM
           265]
          Length = 118

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            + +   +       A +P+       ++ VV+YF +IRPQ+++ + R ++L +L+RGD 
Sbjct: 5   ISALLLFAPPTTGGPAPNPIIQLVPLVLIFVVFYFFMIRPQQKKQKDREKVLESLKRGDR 64

Query: 62  IVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEV 101
           IVT  G+ G V  +  +   + V++A+N +++  RS V+ +
Sbjct: 65  IVTIGGMHGTVAGIDTEKKTVLVQVADNTKIKFDRSAVANI 105


>gi|153875639|ref|ZP_02003351.1| preprotein translocase [Beggiatoa sp. PS]
 gi|152067896|gb|EDN66648.1| preprotein translocase [Beggiatoa sp. PS]
          Length = 109

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 58/106 (54%), Gaps = 5/106 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +    +AQ+           L    +  VL +V+YFLLIRPQ ++++   +M+ +L +GD
Sbjct: 4   LIQNAWAQAAGQGDAG----LINLIMLVVLFLVFYFLLIRPQTKRVKEHKQMVESLAKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT  G++GK+ ++  D  + +E++ N  ++V R  V+ V  K  
Sbjct: 60  EVVTNGGLLGKITQL-GDNFMTLEVSANTEIKVQRQSVAAVMPKGT 104


>gi|146310537|ref|YP_001175611.1| preprotein translocase subunit YajC [Enterobacter sp. 638]
 gi|145317413|gb|ABP59560.1| protein translocase subunit yajC [Enterobacter sp. 638]
          Length = 110

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP   S  SP+ +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD 
Sbjct: 5   ISDAVAATGAP---SQGSPMSLILMLAVFGLIFYFMILRPQQKRTKEHKNLMSSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAETGYISIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|114767460|ref|ZP_01446247.1| preprotein translocase, YajC subunit [Pelagibaca bermudensis
           HTCC2601]
 gi|114540470|gb|EAU43551.1| preprotein translocase, YajC subunit [Roseovarius sp. HTCC2601]
          Length = 95

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/90 (45%), Positives = 64/90 (71%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            + L       ++  + YFLLIRPQ+++++   +M+  LRRGD +VT  GI+GKV +V D
Sbjct: 3   PAALGQFLPLILIFAIMYFLLIRPQQKKMKEHQKMVAALRRGDQVVTQGGIIGKVAKVKD 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           + E++VEIAE V+VRVV++ V++V SK+EP
Sbjct: 63  NNEIDVEIAEGVKVRVVQNTVTQVLSKTEP 92


>gi|194334904|ref|YP_002016764.1| preprotein translocase subunit YajC [Prosthecochloris aestuarii DSM
           271]
 gi|194312722|gb|ACF47117.1| preprotein translocase, YajC subunit [Prosthecochloris aestuarii
           DSM 271]
          Length = 117

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 1/101 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           F   +     PA     +P        ++ VV+YF LIRPQ+++ + R ++L +L+RGD 
Sbjct: 4   FILSFLLFAPPAGGQTPNPFVQLVPLVLIFVVFYFFLIRPQQKKQKEREKVLDSLKRGDK 63

Query: 62  IVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEV 101
           IVT  G+ G V  +  +   + ++IA+N +V   RS V+ +
Sbjct: 64  IVTIGGMHGTVAGIDSEKKTVLIQIADNQKVTFDRSAVASI 104


>gi|99080836|ref|YP_612990.1| protein translocase subunit yajC [Ruegeria sp. TM1040]
 gi|99037116|gb|ABF63728.1| protein translocase subunit yajC [Ruegeria sp. TM1040]
          Length = 94

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 63/90 (70%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + YFLLIRPQ++++++   M+  LRRGD +VT  G++GKV +V +
Sbjct: 3   GGAIAQFIPLILIFAIMYFLLIRPQQKKMKQHQNMVEALRRGDQVVTQGGVIGKVSKVKE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D ELE+EIAE V+VRVV+S +++V +K+EP
Sbjct: 63  DGELEIEIAEGVKVRVVKSTIAQVLNKTEP 92


>gi|148263779|ref|YP_001230485.1| preprotein translocase, YajC subunit [Geobacter uraniireducens Rf4]
 gi|146397279|gb|ABQ25912.1| protein translocase subunit yajC [Geobacter uraniireducens Rf4]
          Length = 106

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 3/107 (2%)

Query: 1   MFTTVYAQS--DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRR 58
           M    +A             S L        +  ++YFLLIRPQ+++ +    +L  L++
Sbjct: 1   MLGLAFAMGTPAGGQAAGGQSALMNLVPLVFMFAIFYFLLIRPQQKKAKEHRALLDTLKK 60

Query: 59  GDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           GD +VTA G+ GKV  + D+  + +E+A  V +++ + F++ +  K 
Sbjct: 61  GDMVVTAGGMHGKVTSI-DENVVTLEVAPGVNIKINKGFIANLMKKD 106


>gi|126174993|ref|YP_001051142.1| preprotein translocase subunit YajC [Shewanella baltica OS155]
 gi|153001322|ref|YP_001367003.1| preprotein translocase subunit YajC [Shewanella baltica OS185]
 gi|160875991|ref|YP_001555307.1| preprotein translocase subunit YajC [Shewanella baltica OS195]
 gi|217972748|ref|YP_002357499.1| preprotein translocase subunit YajC [Shewanella baltica OS223]
 gi|304411827|ref|ZP_07393438.1| preprotein translocase, YajC subunit [Shewanella baltica OS183]
 gi|307303405|ref|ZP_07583160.1| preprotein translocase, YajC subunit [Shewanella baltica BA175]
 gi|125998198|gb|ABN62273.1| protein translocase subunit yajC [Shewanella baltica OS155]
 gi|151365940|gb|ABS08940.1| preprotein translocase, YajC subunit [Shewanella baltica OS185]
 gi|160861513|gb|ABX50047.1| preprotein translocase, YajC subunit [Shewanella baltica OS195]
 gi|217497883|gb|ACK46076.1| preprotein translocase, YajC subunit [Shewanella baltica OS223]
 gi|304349687|gb|EFM14094.1| preprotein translocase, YajC subunit [Shewanella baltica OS183]
 gi|306913765|gb|EFN44187.1| preprotein translocase, YajC subunit [Shewanella baltica BA175]
 gi|315268187|gb|ADT95040.1| preprotein translocase, YajC subunit [Shewanella baltica OS678]
          Length = 110

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA +        T  +E+  +  +  +++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 3   ISNAYASAAGAPQGGGT--MELIFMLAIFGLIFYFMIFRPQSKRVKEHKNLMSSISKGDE 60

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T+ GI+GK+ ++ D+   + + + +  ++ + + +++ V  K 
Sbjct: 61  VLTSGGILGKIAKISDESDYVLLSLNDTTQITIKKDYIAAVLPKG 105


>gi|161504408|ref|YP_001571520.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|296101528|ref|YP_003611674.1| preprotein translocase subunit YajC [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|160865755|gb|ABX22378.1| hypothetical protein SARI_02519 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|295055987|gb|ADF60725.1| preprotein translocase subunit YajC [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 110

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAESGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|319944503|ref|ZP_08018774.1| YajC protein [Lautropia mirabilis ATCC 51599]
 gi|319742216|gb|EFV94632.1| YajC protein [Lautropia mirabilis ATCC 51599]
          Length = 127

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 7/109 (6%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +T YAQ+ APA   A S L       ++ V  YFL+IRPQ ++ +    ML  L++GD 
Sbjct: 18  ISTAYAQTAAPA--GAESQLLGFLPIILMFVAMYFLMIRPQMKRAKEHRNMLAALQKGDE 75

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIA----ENVRVRVVRSFVSEVQSKSE 106
           +VTA GIVG+V +V  D  + VE++    +++ +   +S V  +  K  
Sbjct: 76  VVTAGGIVGRVTKV-GDAYVTVEVSASGDKSIEMNFQKSTVQTLLPKGT 123


>gi|212709161|ref|ZP_03317289.1| hypothetical protein PROVALCAL_00194 [Providencia alcalifaciens DSM
           30120]
 gi|212688073|gb|EEB47601.1| hypothetical protein PROVALCAL_00194 [Providencia alcalifaciens DSM
           30120]
          Length = 110

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 56/90 (62%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             SP  +  +  V A+++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V +V 
Sbjct: 17  QGSPYSLIIMLVVFALIFYFMILRPQQKRAKDHRKLMESIAKGDEVLTTGGLIGRVTKVS 76

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +   + +E++EN  V + R FV+ V  K  
Sbjct: 77  ETGYVVLELSENTEVTIKRDFVAAVLPKGT 106


>gi|283784225|ref|YP_003364090.1| preprotein translocase subunit [Citrobacter rodentium ICC168]
 gi|282947679|emb|CBG87234.1| putative preprotein translocase subunit [Citrobacter rodentium
           ICC168]
          Length = 110

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|197283990|ref|YP_002149862.1| preprotein translocase subunit YajC [Proteus mirabilis HI4320]
 gi|227358141|ref|ZP_03842482.1| preprotein translocase subunit [Proteus mirabilis ATCC 29906]
 gi|194681477|emb|CAR40318.1| putative preprotein translocase subunit [Proteus mirabilis HI4320]
 gi|227161477|gb|EEI46514.1| preprotein translocase subunit [Proteus mirabilis ATCC 29906]
          Length = 111

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 57/100 (57%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A + A       S + +  +  +  +++YF+++RPQ+++ +   +++ ++ +GD ++T  
Sbjct: 8   AVASAGQAAPEASFMSILPMLVIFILIFYFMILRPQQKRTKEHRKLMESIGKGDEVLTTG 67

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           G++G+VV+V D+  + V + E   V + R FV+ V  K  
Sbjct: 68  GLIGRVVKVSDNGYIVVALNETTEVTIKRDFVAAVLPKGT 107


>gi|268317605|ref|YP_003291324.1| preprotein translocase, YajC subunit [Rhodothermus marinus DSM
           4252]
 gi|262335139|gb|ACY48936.1| preprotein translocase, YajC subunit [Rhodothermus marinus DSM
           4252]
          Length = 102

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 1/96 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
                  A +PL       ++ VV+YF LIRPQ+++ ++R +M+  L++GD +VT  GI 
Sbjct: 8   AGQPAEGAPNPLVTFLPLILIFVVFYFFLIRPQKKKEEQRQKMIAALKKGDKVVTIGGIH 67

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           G V +V DD  + +++  N ++RV +S V+ V SK 
Sbjct: 68  GTVTQV-DDTSILLQVDSNTKLRVEKSAVATVLSKD 102


>gi|17547433|ref|NP_520835.1| preprotein translocase subunit YajC [Ralstonia solanacearum
           GMI1000]
 gi|17429736|emb|CAD16421.1| probable preprotein translocase subunit yajc transmembrane
           [Ralstonia solanacearum GMI1000]
          Length = 109

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +  YAQ+   A   A + L       ++ VV +F++IRPQ ++ +    ML  L +GD
Sbjct: 1   MISDAYAQTAGAAPGGAGNGLMSFLPIILMFVVLWFIMIRPQMKRQKETKTMLEALAKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VTA GI+GKV +V  D  + VE+A N  + V ++ V+ V  K  
Sbjct: 61  EVVTAGGILGKVTKVT-DQYITVEVAPNTELTVQKNAVTTVLPKGT 105


>gi|299065734|emb|CBJ36910.1| protein translocase auxillary subunit [Ralstonia solanacearum
           CMR15]
          Length = 111

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +  YAQ+   A   A + L       ++ VV +F++IRPQ ++ +    ML  L +GD
Sbjct: 3   MISDAYAQTAGAAPGGAGNGLMSFLPIILMFVVLWFIMIRPQMKRQKETKTMLEALAKGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT+ GI+GKV +V  D  + VE+A N  + V ++ V+ V  K  
Sbjct: 63  EVVTSGGILGKVTKVT-DQYITVEVAPNTELTVQKNAVTTVLPKGT 107


>gi|16759384|ref|NP_455001.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16763786|ref|NP_459401.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29142845|ref|NP_806187.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|62179018|ref|YP_215435.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161615409|ref|YP_001589374.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167551786|ref|ZP_02345539.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167992253|ref|ZP_02573351.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232377|ref|ZP_02657435.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237518|ref|ZP_02662576.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168240226|ref|ZP_02665158.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168261164|ref|ZP_02683137.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168465493|ref|ZP_02699375.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168818986|ref|ZP_02830986.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444866|ref|YP_002039648.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448478|ref|YP_002044440.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194470338|ref|ZP_03076322.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194736494|ref|YP_002113439.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197251743|ref|YP_002145389.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197263191|ref|ZP_03163265.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198244388|ref|YP_002214360.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200389367|ref|ZP_03215978.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204927403|ref|ZP_03218605.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205351718|ref|YP_002225519.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207855888|ref|YP_002242539.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213163214|ref|ZP_03348924.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213420364|ref|ZP_03353430.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213427840|ref|ZP_03360590.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213609613|ref|ZP_03369439.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650159|ref|ZP_03380212.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|224582243|ref|YP_002636041.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|289825049|ref|ZP_06544401.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25302585|pir||AF0552 probable membrane protein STY0444 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16418910|gb|AAL19360.1| preprotein translocase IISP family, membrane subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16501675|emb|CAD08862.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138477|gb|AAO70047.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62126651|gb|AAX64354.1| preprotein translocase IISP family, membrane subunit [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161364773|gb|ABX68541.1| hypothetical protein SPAB_03180 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403529|gb|ACF63751.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194406782|gb|ACF67001.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194456702|gb|EDX45541.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194711996|gb|ACF91217.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195631951|gb|EDX50471.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197215446|gb|ACH52843.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197241446|gb|EDY24066.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289571|gb|EDY28934.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197938904|gb|ACH76237.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199601812|gb|EDZ00358.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204324068|gb|EDZ09263.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205271499|emb|CAR36317.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205323438|gb|EDZ11277.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205329561|gb|EDZ16325.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333454|gb|EDZ20218.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205340318|gb|EDZ27082.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205344154|gb|EDZ30918.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205349957|gb|EDZ36588.1| preprotein translocase, YajC subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206707691|emb|CAR31975.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224466770|gb|ACN44600.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261245689|emb|CBG23485.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992116|gb|ACY87001.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157018|emb|CBW16501.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911439|dbj|BAJ35413.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320084682|emb|CBY94473.1| UPF0092 membrane protein yajC [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321225131|gb|EFX50192.1| Preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322614689|gb|EFY11618.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618795|gb|EFY15683.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322623502|gb|EFY20341.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629200|gb|EFY25979.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631920|gb|EFY28674.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322637342|gb|EFY34044.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642028|gb|EFY38638.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647847|gb|EFY44322.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322652524|gb|EFY48878.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653313|gb|EFY49646.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660538|gb|EFY56774.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664690|gb|EFY60883.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669257|gb|EFY65407.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670803|gb|EFY66936.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678959|gb|EFY75014.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681987|gb|EFY78012.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685184|gb|EFY81181.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322713477|gb|EFZ05048.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323128724|gb|ADX16154.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323194468|gb|EFZ79663.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323196996|gb|EFZ82138.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323203980|gb|EFZ88997.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206934|gb|EFZ91887.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210848|gb|EFZ95720.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214538|gb|EFZ99289.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323223095|gb|EGA07438.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323227045|gb|EGA11226.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230138|gb|EGA14258.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233876|gb|EGA17965.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323238430|gb|EGA22488.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244118|gb|EGA28127.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246278|gb|EGA30261.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323251904|gb|EGA35767.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257901|gb|EGA41580.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261086|gb|EGA44678.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264984|gb|EGA48483.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323272547|gb|EGA55954.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326622109|gb|EGE28454.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326626751|gb|EGE33094.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332987354|gb|AEF06337.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 110

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|187930026|ref|YP_001900513.1| preprotein translocase subunit YajC [Ralstonia pickettii 12J]
 gi|241664131|ref|YP_002982491.1| preprotein translocase subunit YajC [Ralstonia pickettii 12D]
 gi|309781306|ref|ZP_07676042.1| preprotein translocase, YajC subunit [Ralstonia sp. 5_7_47FAA]
 gi|187726916|gb|ACD28081.1| preprotein translocase, YajC subunit [Ralstonia pickettii 12J]
 gi|240866158|gb|ACS63819.1| preprotein translocase, YajC subunit [Ralstonia pickettii 12D]
 gi|308919719|gb|EFP65380.1| preprotein translocase, YajC subunit [Ralstonia sp. 5_7_47FAA]
          Length = 110

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YAQ+ APA   A   L       ++ VV +F++IRPQ ++ +    ML  L +GD
Sbjct: 3   LISDAYAQT-APAAGGAAGGLMSFLPIILMFVVLWFIMIRPQMKRQKETKAMLEALAKGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VTA GI+GKV +V +   + VEIA N  + V +S V+ V  K  
Sbjct: 62  EVVTAGGILGKVSKVAE-QYVTVEIAANTEITVQKSAVTTVLPKGT 106


>gi|89072681|ref|ZP_01159246.1| preprotein translocase subunit YajC [Photobacterium sp. SKA34]
 gi|89051501|gb|EAR56955.1| preprotein translocase subunit YajC [Photobacterium sp. SKA34]
          Length = 111

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 56/106 (52%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A   A         +++  +  + AV++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 5   ISQAHA---AAEGAPQGGSMQLFIMLGLFAVIFYFMIYRPQAKRVKEHKSLMSSMGKGDE 61

Query: 62  IVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G++ +V  +   + + + +N  V + + F+S V  K  
Sbjct: 62  VMTNGGLLGRITKVSAESDYIVLALNDNTEVTIKKDFISAVLPKGT 107


>gi|193214855|ref|YP_001996054.1| preprotein translocase, YajC subunit [Chloroherpeton thalassium
           ATCC 35110]
 gi|193088332|gb|ACF13607.1| preprotein translocase, YajC subunit [Chloroherpeton thalassium
           ATCC 35110]
          Length = 119

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 54/98 (55%), Gaps = 1/98 (1%)

Query: 5   VYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVT 64
            +     P+    T+P        ++ VV+YF LIRPQ+++ + R  +L  +++GD +VT
Sbjct: 9   AFLLFAPPSGGEQTNPFVQLIPLALIFVVFYFFLIRPQQKKQKERESLLETIKKGDRVVT 68

Query: 65  AAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEV 101
             GI G V  +  D   + V++++ V+++  +S +S +
Sbjct: 69  IGGIHGTVAGIDSDKKTVLVQVSDTVKLKFDKSAISSI 106


>gi|288818923|ref|YP_003433271.1| preprotein translocase YajC subunit [Hydrogenobacter thermophilus
           TK-6]
 gi|288788323|dbj|BAI70070.1| preprotein translocase YajC subunit [Hydrogenobacter thermophilus
           TK-6]
 gi|308752510|gb|ADO45993.1| preprotein translocase, YajC subunit [Hydrogenobacter thermophilus
           TK-6]
          Length = 112

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 53/105 (50%), Gaps = 2/105 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M    +AQ  A     A +          +  ++YFL+IRPQ++  +R  E L NL++GD
Sbjct: 1   MIDIAFAQQTAQ-GGPAGAFFVQLVFLIGIFAIFYFLMIRPQQKARKRHQEFLANLKKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            ++T+ GI G VV + +D  + + +  N R+   +  +   Q K+
Sbjct: 60  KVITSGGIWGTVVEIGED-TITLRVDANTRITFTKEAIVSYQPKA 103


>gi|21672906|ref|NP_660971.1| hypothetical protein CT0065 [Chlorobium tepidum TLS]
 gi|21645960|gb|AAM71313.1| conserved hypothetical protein [Chlorobium tepidum TLS]
          Length = 117

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 57/98 (58%), Gaps = 1/98 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
             PA  +  +P        ++ VV+YF +IRPQ+++ + R  +L +++RGD +VT  GI 
Sbjct: 12  APPAGGATPNPFVQLVPLVLIFVVFYFFMIRPQQKKQKERESLLNDIKRGDRVVTIGGIH 71

Query: 70  GKVVRV-IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           G V  +  +   + V++A+NV+++  RS ++ ++ +  
Sbjct: 72  GTVAGIETEKKTVLVQVADNVKIKFERSAIANIEKQET 109


>gi|91977248|ref|YP_569907.1| preprotein translocase, YajC subunit [Rhodopseudomonas palustris
           BisB5]
 gi|91683704|gb|ABE40006.1| protein translocase subunit yajC [Rhodopseudomonas palustris BisB5]
          Length = 146

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 75/108 (69%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF T      A A   A S +     F ++ V+ YFL++RPQ+++++  AE+++N+RRGD
Sbjct: 1   MFVTPAFAQAAAAGGDANSMMMSLLPFALIFVIMYFLILRPQQRKVKEHAELVKNIRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +I+T+ G+VGKV +V+DD ++E E+A+ VRVR +R  ++ V++K EPV
Sbjct: 61  TIITSGGLVGKVTKVVDDDQIEFEVADGVRVRQMRQMITGVRTKGEPV 108


>gi|114331421|ref|YP_747643.1| preprotein translocase, YajC subunit [Nitrosomonas eutropha C91]
 gi|114308435|gb|ABI59678.1| protein translocase subunit yajC [Nitrosomonas eutropha C91]
          Length = 154

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +    +AQ+      ++   L        + V++YFLLIRPQ ++ + + +M   L++GD
Sbjct: 2   LIKEAFAQAANSTAQTSDPTLMSFLPMIGIVVIFYFLLIRPQTKRAKEQKQMQNELQKGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            I+ + G +G+VV    D  L +EIA  V + V++S V  +  K  
Sbjct: 62  EIIISGGELGRVVS-TGDSYLTMEIAVGVEITVLKSSVQTLLPKGT 106


>gi|258619940|ref|ZP_05714980.1| preprotein translocase subunit YajC [Vibrio mimicus VM573]
 gi|258626959|ref|ZP_05721761.1| preprotein translocase subunit YajC [Vibrio mimicus VM603]
 gi|262172187|ref|ZP_06039865.1| preprotein translocase subunit YajC [Vibrio mimicus MB-451]
 gi|258580783|gb|EEW05730.1| preprotein translocase subunit YajC [Vibrio mimicus VM603]
 gi|258587673|gb|EEW12382.1| preprotein translocase subunit YajC [Vibrio mimicus VM573]
 gi|261893263|gb|EEY39249.1| preprotein translocase subunit YajC [Vibrio mimicus MB-451]
          Length = 111

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 59/107 (55%), Gaps = 3/107 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +A  +  A        EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD
Sbjct: 3   LISVAHAAGEGAAPQGGG--FEMIIMLGMFAVIFYFMIYRPQAKRVKEHKSLMSSMAKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+VG++ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 61  EVLTSGGLVGRITKISEDNAYITIELNTNNEVVIKKDFVTAVLPKGT 107


>gi|254463071|ref|ZP_05076487.1| preprotein translocase, YajC subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206679660|gb|EDZ44147.1| preprotein translocase, YajC subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 95

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/89 (44%), Positives = 62/89 (69%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
             L       ++  + YFLLIRPQ+++L+   +M+  LRRGD ++T  G++GKV +V DD
Sbjct: 4   GALGQFVPLILIFAIMYFLLIRPQQKKLKEHQKMVEALRRGDQVITQGGLIGKVTKVKDD 63

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            E+EVE+AE V+VRVV+S ++ V +K+EP
Sbjct: 64  NEIEVELAEGVKVRVVQSTITNVINKTEP 92


>gi|268592078|ref|ZP_06126299.1| preprotein translocase, YajC subunit [Providencia rettgeri DSM
           1131]
 gi|291312473|gb|EFE52926.1| preprotein translocase, YajC subunit [Providencia rettgeri DSM
           1131]
          Length = 110

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 56/90 (62%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             SP  M  +  V A+++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V +V 
Sbjct: 17  QGSPYTMVIMLVVFALIFYFMILRPQQKRAKEHRKLMESITKGDEVLTTGGLIGRVTKVS 76

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +   + +E++EN  V + R FV+ V  K  
Sbjct: 77  ETGYVVLELSENTEVTIKRDFVAAVLPKGT 106


>gi|90414613|ref|ZP_01222586.1| preprotein translocase subunit YajC [Photobacterium profundum 3TCK]
 gi|90324329|gb|EAS40898.1| preprotein translocase subunit YajC [Photobacterium profundum 3TCK]
          Length = 111

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 54/100 (54%), Gaps = 1/100 (1%)

Query: 8   QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAG 67
            + A         +++  +  + AV++YF++ RPQ ++ +    ++ ++ +GD ++T  G
Sbjct: 8   ANAAAEGAPQGGSMQLFIMLGLFAVIFYFMIYRPQAKRAKEHKTLMSSMGKGDEVLTNGG 67

Query: 68  IVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++GK+ +V ++   + + + +N  V + + FV+ V  K  
Sbjct: 68  LLGKITKVSEETDYIVIALNDNNEVTIKKDFVTAVLPKGT 107


>gi|255263258|ref|ZP_05342600.1| preprotein translocase, YajC subunit [Thalassiobium sp. R2A62]
 gi|255105593|gb|EET48267.1| preprotein translocase, YajC subunit [Thalassiobium sp. R2A62]
          Length = 95

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/91 (40%), Positives = 60/91 (65%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
                       ++  + YFLLIRPQ+++L+    M+  LRRGD ++TA G+VGKV +V 
Sbjct: 2   QGGAFAQFIPLILIFAIMYFLLIRPQQKKLKEHQAMVEALRRGDEVITAGGLVGKVTKVR 61

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D+ E++VE+A+ V VRV++S ++ V +K+EP
Sbjct: 62  DNGEVDVEVAKGVNVRVIKSTITTVLNKTEP 92


>gi|260575192|ref|ZP_05843192.1| preprotein translocase, YajC subunit [Rhodobacter sp. SW2]
 gi|259022452|gb|EEW25748.1| preprotein translocase, YajC subunit [Rhodobacter sp. SW2]
          Length = 112

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 60/87 (68%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L       ++  + YFLLIRPQ+++L+    M+  LRRGD ++T  GI+GKV +V DD  
Sbjct: 22  LTSFVPLILIFAIMYFLLIRPQQKKLKEHNAMVEALRRGDQVLTQGGIIGKVTKVHDDGI 81

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           LEVEIAE V+VRV RS +++V SK+EP
Sbjct: 82  LEVEIAEGVKVRVPRSTIAQVMSKTEP 108


>gi|49474116|ref|YP_032158.1| hypothetical protein BQ04800 [Bartonella quintana str. Toulouse]
 gi|49239620|emb|CAF25979.1| hypothetical protein BQ04800 [Bartonella quintana str. Toulouse]
          Length = 150

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/108 (43%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ         +  L     F ++  + YF +IRPQR Q+++R EML ++RRGD+
Sbjct: 3   ITNAYAQVAGDVSNGPS--LVTFVPFILIFGIMYFFMIRPQRAQMKKRKEMLDSVRRGDT 60

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +VT  GI+GKV +V D+  ELEVEI + +RVRV+R  +S+V+ K EP+
Sbjct: 61  VVTGGGIIGKVTKVYDESGELEVEICDGMRVRVIRLTLSDVRVKGEPI 108


>gi|259909287|ref|YP_002649643.1| preprotein translocase subunit YajC [Erwinia pyrifoliae Ep1/96]
 gi|224964909|emb|CAX56432.1| conserved uncharacterized protein YajC [Erwinia pyrifoliae Ep1/96]
 gi|283479342|emb|CAY75258.1| UPF0092 membrane protein yajC [Erwinia pyrifoliae DSM 12163]
          Length = 109

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 57/98 (58%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           + A A  S +SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+
Sbjct: 8   AVAAAAPSQSSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIAKGDEVLTTGGL 67

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           VG+V +V +   + + + +   V V R FV+ V  K  
Sbjct: 68  VGRVTKVAETGYVAIALNDTTEVVVKRDFVAAVLPKGT 105


>gi|284006393|emb|CBA71629.1| preprotein translocase subunit [Arsenophonus nasoniae]
          Length = 111

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 23/105 (21%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A +D        +P  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 6   ISDAVASADGQT---QGNPYSLIIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSISKGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V +   + V + +   V + R FV+ V  K  
Sbjct: 63  VLTTGGLIGRVTKVSETGYIVVALNDTNEVTIKRDFVAAVLPKGT 107


>gi|261346391|ref|ZP_05974035.1| preprotein translocase, YajC subunit [Providencia rustigianii DSM
           4541]
 gi|282565709|gb|EFB71244.1| preprotein translocase, YajC subunit [Providencia rustigianii DSM
           4541]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 56/90 (62%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             SP  +  +  V A+++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V +V 
Sbjct: 17  QGSPYSLIIMLVVFALIFYFMILRPQQKRAKDHRKLMESIAKGDEVLTTGGLIGRVNKVS 76

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +   + +E++EN  V + R FV+ V  K  
Sbjct: 77  ETGYVVLELSENTEVTIKRDFVAAVLPKGT 106


>gi|123443372|ref|YP_001007346.1| preprotein translocase subunit YajC [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090333|emb|CAL13199.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|330863960|emb|CBX74044.1| UPF0092 membrane protein yajC [Yersinia enterocolitica W22703]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA    +SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVASAGAPA---QSSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTTGGLLGRVTKVAETGYIVIALNDTTEVMIKRDFVAAVLPKGT 106


>gi|51595279|ref|YP_069470.1| preprotein translocase subunit YajC [Yersinia pseudotuberculosis IP
           32953]
 gi|108808676|ref|YP_652592.1| preprotein translocase subunit YajC [Yersinia pestis Antiqua]
 gi|108811062|ref|YP_646829.1| preprotein translocase subunit YajC [Yersinia pestis Nepal516]
 gi|145600084|ref|YP_001164160.1| preprotein translocase subunit YajC [Yersinia pestis Pestoides F]
 gi|149364964|ref|ZP_01886999.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|153948200|ref|YP_001402082.1| preprotein translocase subunit YajC [Yersinia pseudotuberculosis IP
           31758]
 gi|161484855|ref|NP_668322.2| preprotein translocase subunit YajC [Yersinia pestis KIM 10]
 gi|161511434|ref|NP_992129.2| preprotein translocase subunit YajC [Yersinia pestis biovar
           Microtus str. 91001]
 gi|162421415|ref|YP_001607726.1| preprotein translocase subunit YajC [Yersinia pestis Angola]
 gi|165926587|ref|ZP_02222419.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936089|ref|ZP_02224659.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011109|ref|ZP_02232007.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213036|ref|ZP_02239071.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399381|ref|ZP_02304905.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421476|ref|ZP_02313229.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423623|ref|ZP_02315376.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170025480|ref|YP_001721985.1| preprotein translocase subunit YajC [Yersinia pseudotuberculosis
           YPIII]
 gi|186894296|ref|YP_001871408.1| preprotein translocase subunit YajC [Yersinia pseudotuberculosis
           PB1/+]
 gi|218930220|ref|YP_002348095.1| preprotein translocase subunit YajC [Yersinia pestis CO92]
 gi|229838795|ref|ZP_04458954.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229896051|ref|ZP_04511221.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           Pestoides A]
 gi|229899363|ref|ZP_04514506.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229901290|ref|ZP_04516412.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           Nepal516]
 gi|270489479|ref|ZP_06206553.1| preprotein translocase, YajC subunit [Yersinia pestis KIM D27]
 gi|294504918|ref|YP_003568980.1| preprotein translocase subunit YajC [Yersinia pestis Z176003]
 gi|51588561|emb|CAH20169.1| putative preprotein translocase IISP family, membrane subunit
           [Yersinia pseudotuberculosis IP 32953]
 gi|108774710|gb|ABG17229.1| protein translocase subunit yajC [Yersinia pestis Nepal516]
 gi|108780589|gb|ABG14647.1| protein translocase subunit yajC [Yersinia pestis Antiqua]
 gi|115348831|emb|CAL21785.1| putative membrane protein [Yersinia pestis CO92]
 gi|145211780|gb|ABP41187.1| protein translocase subunit yajC [Yersinia pestis Pestoides F]
 gi|149291377|gb|EDM41451.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|152959695|gb|ABS47156.1| preprotein translocase, YajC subunit [Yersinia pseudotuberculosis
           IP 31758]
 gi|162354230|gb|ABX88178.1| preprotein translocase, YajC subunit [Yersinia pestis Angola]
 gi|165916234|gb|EDR34841.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921515|gb|EDR38712.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990109|gb|EDR42410.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205823|gb|EDR50303.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960395|gb|EDR56416.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051885|gb|EDR63293.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057793|gb|EDR67539.1| preprotein translocase, YajC subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169752014|gb|ACA69532.1| preprotein translocase, YajC subunit [Yersinia pseudotuberculosis
           YPIII]
 gi|186697322|gb|ACC87951.1| preprotein translocase, YajC subunit [Yersinia pseudotuberculosis
           PB1/+]
 gi|229681219|gb|EEO77313.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           Nepal516]
 gi|229687765|gb|EEO79838.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229695161|gb|EEO85208.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229700974|gb|EEO89003.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           Pestoides A]
 gi|262362983|gb|ACY59704.1| preprotein translocase subunit YajC [Yersinia pestis D106004]
 gi|262366904|gb|ACY63461.1| preprotein translocase subunit YajC [Yersinia pestis D182038]
 gi|270337983|gb|EFA48760.1| preprotein translocase, YajC subunit [Yersinia pestis KIM D27]
 gi|294355377|gb|ADE65718.1| preprotein translocase subunit YajC [Yersinia pestis Z176003]
 gi|320016377|gb|ADV99948.1| SecYEG protein translocase auxillary subunit [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 111

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 55/100 (55%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A + A A     S   M  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T+ 
Sbjct: 8   AVASAGAPAQGNSMTSMLIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDEVLTSG 67

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           G +G+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 68  GFIGRVTKVAETGYVVIALNDTTEVMIKRDFVAAVLPKGT 107


>gi|149204171|ref|ZP_01881139.1| preprotein translocase, YajC subunit [Roseovarius sp. TM1035]
 gi|149142613|gb|EDM30658.1| preprotein translocase, YajC subunit [Roseovarius sp. TM1035]
          Length = 93

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/87 (45%), Positives = 61/87 (70%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   ++  + YFLLIRPQ+++L+    M+  LRRGD +VT  G++GKV +V DD E
Sbjct: 4   FSQFIPLILIFAIMYFLLIRPQQKKLKEHKAMIGALRRGDQVVTQGGLIGKVSKVKDDSE 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +EVE+AE ++VRVVR+ +++V SK+EP
Sbjct: 64  IEVELAEGIKVRVVRATIAQVLSKTEP 90


>gi|238918973|ref|YP_002932487.1| preprotein translocase, YajC subunit, [Edwardsiella ictaluri
           93-146]
 gi|238868541|gb|ACR68252.1| preprotein translocase, YajC subunit, putative [Edwardsiella
           ictaluri 93-146]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVASAGAPA---QGSPYSLVIMLVVFGLIFYFMILRPQQKRTKEHKKLMDSISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V D   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLIGRVAKVADTGYITIALNDTTEVIIKRDFVTAVLPKGT 106


>gi|328954309|ref|YP_004371643.1| preprotein translocase, YajC subunit [Desulfobacca acetoxidans DSM
           11109]
 gi|328454633|gb|AEB10462.1| preprotein translocase, YajC subunit [Desulfobacca acetoxidans DSM
           11109]
          Length = 109

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 4   TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
             YA + A      +S L       ++  ++Y LLIRPQ+++ +     L NL++GD +V
Sbjct: 9   LAYAMAGASGEAGGSSGLLTILPLILMFGIFYVLLIRPQQKKAKEHRSFLENLKKGDKVV 68

Query: 64  TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
           TA G+ G++  +  D  + +EIA+ +RV+V R +++    K
Sbjct: 69  TAGGLYGEITGMT-DQSVTLEIADRIRVKVGRGYIANFAPK 108


>gi|317047144|ref|YP_004114792.1| preprotein translocase subunit YajC [Pantoea sp. At-9b]
 gi|316948761|gb|ADU68236.1| preprotein translocase, YajC subunit [Pantoea sp. At-9b]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP   S  SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAAAGAP---SQGSPYSLVIMLVVFGLIFYFMILRPQQKRSKEHKKLMDSISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|39935899|ref|NP_948175.1| preprotein translocase subunit YajC [Rhodopseudomonas palustris
           CGA009]
 gi|39649753|emb|CAE28274.1| putative membrane protein, possible preprotein translocase
           [Rhodopseudomonas palustris CGA009]
          Length = 145

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 73/108 (67%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF T      A A   A S +     F ++ V+ YFL++RPQ+++++  AEM++N+RRGD
Sbjct: 1   MFVTPAYAQAAAAGGDANSMIMSLLPFALIFVIMYFLILRPQQKKVKEHAEMVKNIRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +I+T+ G+VGKV +VIDD  +E E+A+ +R R +R  ++ V++K EPV
Sbjct: 61  TIITSGGLVGKVTKVIDDDTVEFELADGIRARQMRQMITGVRAKGEPV 108


>gi|311280705|ref|YP_003942936.1| preprotein translocase, YajC subunit [Enterobacter cloacae SCF1]
 gi|308749900|gb|ADO49652.1| preprotein translocase, YajC subunit [Enterobacter cloacae SCF1]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKDHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|269138316|ref|YP_003295016.1| preprotein translocase subunit YajC [Edwardsiella tarda EIB202]
 gi|267983976|gb|ACY83805.1| preprotein translocase subunit YajC [Edwardsiella tarda EIB202]
 gi|304558347|gb|ADM41011.1| Preprotein translocase subunit YajC [Edwardsiella tarda FL6-60]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVASAGAPA---QGSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+VV+V D   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLIGRVVKVADTGYIAIALNDTTEVIIKRDFVTAVLPKGT 106


>gi|294083977|ref|YP_003550734.1| YajC [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663549|gb|ADE38650.1| YajC [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 109

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 70/108 (64%), Gaps = 5/108 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ+                    + V++YFLLIRPQ+++ ++  EML  LRRGD 
Sbjct: 3   ISPAFAQASGGLAEGGFG----LLPIIFVMVIFYFLLIRPQQKRAKQHKEMLGALRRGDK 58

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           I+T+ G+ G +V+V+DD   +EVEIA++V+V +VRS ++++Q+K+EPV
Sbjct: 59  IITSGGLTGSIVKVVDDSETVEVEIAKDVKVHIVRSMIADIQNKTEPV 106


>gi|256822293|ref|YP_003146256.1| preprotein translocase subunit YajC [Kangiella koreensis DSM 16069]
 gi|256795832|gb|ACV26488.1| preprotein translocase, YajC subunit [Kangiella koreensis DSM
           16069]
          Length = 104

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 57/96 (59%), Gaps = 1/96 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A A       +    +F  L ++ YF++IRPQ++++++  EM+ +L +GD ++T  GI+G
Sbjct: 4   ATAAPQGGGLMSFLVMFVPLILIMYFMMIRPQQKKMKQHKEMVSSLEKGDEVMTTGGILG 63

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++ ++ DD  + V I++ + ++  ++ +++   K  
Sbjct: 64  RISKIKDDF-IVVSISDGIEIKFQKAAIAQTLPKGT 98


>gi|90579385|ref|ZP_01235195.1| preprotein translocase subunit YajC [Vibrio angustum S14]
 gi|90440218|gb|EAS65399.1| preprotein translocase subunit YajC [Vibrio angustum S14]
          Length = 111

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 56/106 (52%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A   A         +++  +  + AV++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 5   ISQAHA---AAEGAPQGGSMQLFIMLGLFAVIFYFMIYRPQAKRVKEHKSLMSSMGKGDE 61

Query: 62  IVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G++ +V  +   + + + +N  V + + F++ V  K  
Sbjct: 62  VMTNGGLLGRITKVSAESDYIVLALNDNTEVTIKKDFITAVLPKGT 107


>gi|188534663|ref|YP_001908460.1| preprotein translocase subunit YajC [Erwinia tasmaniensis Et1/99]
 gi|188029705|emb|CAO97584.1| Conserved hypothetical protein YajC [Erwinia tasmaniensis Et1/99]
          Length = 109

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 57/98 (58%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           + A A  S +SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+
Sbjct: 8   AVAAAAPSQSSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIAKGDEVLTTGGL 67

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           VG+V +V +   + + + +   V V R FV+ V  K  
Sbjct: 68  VGRVTKVAETGYVAIALNDTTEVVVKRDFVAAVLPKGT 105


>gi|187733401|ref|YP_001879114.1| preprotein translocase subunit YajC [Shigella boydii CDC 3083-94]
 gi|187430393|gb|ACD09667.1| preprotein translocase, YajC subunit [Shigella boydii CDC 3083-94]
          Length = 110

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP      SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPV---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V ++  + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|222148962|ref|YP_002549919.1| preprotein tranlocase protein [Agrobacterium vitis S4]
 gi|221735948|gb|ACM36911.1| preprotein tranlocase protein [Agrobacterium vitis S4]
          Length = 123

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 65/94 (69%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               S  EM  LF  L V+WYFLLIRPQR QL++R   L  +RRGD +V   G++GKV +
Sbjct: 16  GGMGSGFEMLLLFAPLMVIWYFLLIRPQRNQLKKREATLSAIRRGDQVVLGGGLIGKVTK 75

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           V DD ELEVEIA+ V+V+ +RS ++EV+ K EPV
Sbjct: 76  VTDDKELEVEIADGVKVKALRSLIAEVRVKGEPV 109


>gi|325981735|ref|YP_004294137.1| preprotein translocase, YajC subunit [Nitrosomonas sp. AL212]
 gi|325531254|gb|ADZ25975.1| preprotein translocase, YajC subunit [Nitrosomonas sp. AL212]
          Length = 152

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 57/106 (53%), Gaps = 2/106 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +    +AQ  A +   + +          + V++YFLLIRPQ ++ +   +M+  L+RGD
Sbjct: 2   LINDAFAQ-AASSTAQSDAGWVTLLPMIGILVLFYFLLIRPQAKRAKEHKQMVEELQRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T  GI+G+++ V +   + +EIA  + V V++S V  +  K  
Sbjct: 61  EVITNGGILGQILNVSEA-YVIIEIAPAMEVTVLKSSVQTLLPKGT 105


>gi|260427509|ref|ZP_05781488.1| preprotein translocase, YajC subunit [Citreicella sp. SE45]
 gi|260422001|gb|EEX15252.1| preprotein translocase, YajC subunit [Citreicella sp. SE45]
          Length = 95

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 65/90 (72%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           TS +       ++  + YFLLIRPQ+++++   +M+  LRRGD +VT  GI+GKV +V +
Sbjct: 3   TSAIAQFIPLILIFAIMYFLLIRPQQKKMKDHQKMVTALRRGDQVVTQGGIIGKVSKVKE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           + E+E+EIA+ VRVRVV++ +++V SK+EP
Sbjct: 63  NNEVEIEIADGVRVRVVQNTIAQVLSKTEP 92


>gi|13471173|ref|NP_102742.1| hypothetical protein mll1072 [Mesorhizobium loti MAFF303099]
 gi|260459798|ref|ZP_05808052.1| preprotein translocase, YajC subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|14021917|dbj|BAB48528.1| probable membrane protein [Mesorhizobium loti MAFF303099]
 gi|259034600|gb|EEW35857.1| preprotein translocase, YajC subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 113

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  YAQ    A   +         F ++ V+ YFL+IRPQR QL++R EML  +RRG
Sbjct: 1   MFVTPAYAQGIGGA---SPDMFISILPFVLIFVIMYFLIIRPQRTQLKKRGEMLAAVRRG 57

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  G VGKV +VIDD ELE+++    +V  +RS +++V+ K EPV
Sbjct: 58  DTVVTGGGFVGKVTKVIDDNELEIDLGGGTKVTALRSTIADVRVKGEPV 106


>gi|253687415|ref|YP_003016605.1| preprotein translocase, YajC subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251753993|gb|ACT12069.1| preprotein translocase, YajC subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 110

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPYSLVIMLAVFGLIFYFMILRPQQKRAKEHKKLMDSISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + E   V + R FV+ V  K  
Sbjct: 62  VLTTGGLVGRVTKVSETGYIAIALNETNEVVIKRDFVAAVLPKGT 106


>gi|227821943|ref|YP_002825913.1| preprotein translocase [Sinorhizobium fredii NGR234]
 gi|227340942|gb|ACP25160.1| preprotein translocase [Sinorhizobium fredii NGR234]
          Length = 110

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 59/108 (54%), Positives = 73/108 (67%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF T      A         L     F ++ VV YFL+IRPQR Q++RR E+L+N+RRGD
Sbjct: 1   MFITEAFAQTAAPAAGGADILMSILPFILIFVVMYFLIIRPQRAQMKRREELLKNIRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +VT  GIVGKV +V+DD ELEVEIAE ++VRVVRS VSEV+ K EPV
Sbjct: 61  QVVTGGGIVGKVTKVVDDTELEVEIAEGIKVRVVRSGVSEVRVKGEPV 108


>gi|189347771|ref|YP_001944300.1| preprotein translocase subunit YajC [Chlorobium limicola DSM 245]
 gi|189341918|gb|ACD91321.1| preprotein translocase, YajC subunit [Chlorobium limicola DSM 245]
          Length = 118

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
             PA     +P+       ++ VV+YF +IRPQ+++ + R ++L +L+RGD +VT  GI 
Sbjct: 12  APPAGGQNPNPIIQLVPLVLIFVVFYFFMIRPQQKKQKEREKVLDSLKRGDRVVTIGGIH 71

Query: 70  GKVVRVI-DDLELEVEIAENVRVRVVRSFVSEV 101
           G V  +  +   + V++ +NV+++  R+ V+ +
Sbjct: 72  GTVAGIDTEKKTVLVQVGDNVKMKFDRTAVANI 104


>gi|294635293|ref|ZP_06713792.1| preprotein translocase, YajC subunit [Edwardsiella tarda ATCC
           23685]
 gi|291091327|gb|EFE23888.1| preprotein translocase, YajC subunit [Edwardsiella tarda ATCC
           23685]
          Length = 115

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 10  ISDAVASAGAPA---QGSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDE 66

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 67  VLTNGGLIGRVTKVAETGYIAIALNDTTEVIIKRDFVTAVLPKGT 111


>gi|15888882|ref|NP_354563.1| preprotein tranlocase protein [Agrobacterium tumefaciens str. C58]
 gi|15156650|gb|AAK87348.1| preprotein tranlocase protein [Agrobacterium tumefaciens str. C58]
          Length = 115

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 74/107 (69%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           F+  +AQ  +   +   S LEM  LF  L VVWYF LIRPQR Q+++R E L ++RRGD 
Sbjct: 3   FSQAFAQDASGGASGFGSGLEMLFLFAPLMVVWYFFLIRPQRAQMKKRQETLTSIRRGDQ 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V   GIVGKV +VIDD ELEVEIAE V++R  R++++EV+ K E V
Sbjct: 63  VVLGGGIVGKVTKVIDDNELEVEIAEGVKIRAARAYIAEVRVKGEVV 109


>gi|291616517|ref|YP_003519259.1| YajC [Pantoea ananatis LMG 20103]
 gi|291151547|gb|ADD76131.1| YajC [Pantoea ananatis LMG 20103]
 gi|327392948|dbj|BAK10370.1| UPF0092 protein YajC [Pantoea ananatis AJ13355]
          Length = 110

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP   S  SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAAAGAP---SQGSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K 
Sbjct: 62  VLTNGGLVGRVTKVAETGYIAIALNDTTEVVIKRDFVAAVLPKG 105


>gi|77919489|ref|YP_357304.1| preprotein translocase subunit YajC [Pelobacter carbinolicus DSM
           2380]
 gi|77545572|gb|ABA89134.1| protein translocase subunit yajC [Pelobacter carbinolicus DSM 2380]
          Length = 103

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF    A + A      ++P     +  ++  ++YFLLIRPQ+++ +    ++  L+ GD
Sbjct: 1   MFWISEAHAMAAPPGGQSNPYGTVIMLVLMFGIFYFLLIRPQQKRAKEHKNLVDALKVGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
            +VTA GI GKV  V D+  + +E+A  V++++ RS +  V
Sbjct: 61  MVVTAGGIHGKVASVQDE-IVTLEVATGVKIKMNRSSIVSV 100


>gi|227113437|ref|ZP_03827093.1| preprotein translocase subunit YajC [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227327500|ref|ZP_03831524.1| preprotein translocase subunit YajC [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 110

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAPA---QGSPYSLVIMLAVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + E   V + R FV+ V  K  
Sbjct: 62  VLTTGGLVGRVTKVSETGYIAIALNETNEVVIKRDFVAAVLPKGT 106


>gi|56414439|ref|YP_151514.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363360|ref|YP_002142997.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56128696|gb|AAV78202.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094837|emb|CAR60370.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 110

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A +  PA     SP+ +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGTPA---QGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|319783199|ref|YP_004142675.1| preprotein translocase, YajC subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169087|gb|ADV12625.1| preprotein translocase, YajC subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 112

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 71/109 (65%), Gaps = 5/109 (4%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  YAQ     + ++         F ++ V+ YFL+IRPQR QL++R EML  +RRG
Sbjct: 1   MFVTPAYAQ----GVGASPDMFISILPFVLIFVIMYFLIIRPQRTQLKKRGEMLAAVRRG 56

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D++VT  G VGKV +VIDD ELEV++   ++V  +RS +++V+ K EPV
Sbjct: 57  DTVVTGGGFVGKVTKVIDDNELEVDLGNGLKVTALRSTIADVRVKGEPV 105


>gi|86749850|ref|YP_486346.1| preprotein translocase, YajC subunit [Rhodopseudomonas palustris
           HaA2]
 gi|86572878|gb|ABD07435.1| protein translocase subunit yajC [Rhodopseudomonas palustris HaA2]
          Length = 142

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 74/108 (68%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF T      A A   A S L     F ++ V+ YFL++RPQ+++++  AE+++N+RRGD
Sbjct: 1   MFVTPAFAQAAAAGGDANSMLMSLLPFALIFVIMYFLILRPQQRKVKEHAELVKNIRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +I+T+ G+VGKV +V+DD ++E E+A+ VR R +R  ++ V++K EPV
Sbjct: 61  TIITSGGLVGKVTKVVDDDQIEFELADGVRARQMRQMITGVRTKGEPV 108


>gi|260771414|ref|ZP_05880339.1| preprotein translocase subunit YajC [Vibrio furnissii CIP 102972]
 gi|260613540|gb|EEX38734.1| preprotein translocase subunit YajC [Vibrio furnissii CIP 102972]
 gi|315180995|gb|ADT87909.1| conserved hypothetical protein [Vibrio furnissii NCTC 11218]
          Length = 110

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +A   A          EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD
Sbjct: 3   LISVAHA---AGEGAPQGGGFEMLIMLGMFAVIFYFMIYRPQSKRVKEHKSLMASMGKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+VGK+ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 60  EVLTSGGLVGKITKIAEDNDYISIELNTNNEVVIKKDFVTAVLPKGT 106


>gi|319404542|emb|CBI78148.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 152

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ+   + TS  +       F ++  + YFL+IRPQR Q+++R EML  +RRGD
Sbjct: 2   LITNAYAQTV--SHTSNGTSFITFVPFILIFAIMYFLIIRPQRAQMKKRQEMLNAVRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +++T  GI+GKV +V D+  ELEVEI+E +R+RV+RS +++V+ K EP+
Sbjct: 60  TVITGGGILGKVTKVYDESGELEVEISEGIRIRVIRSTLADVRIKGEPL 108


>gi|254466430|ref|ZP_05079841.1| preprotein translocase, YajC subunit [Rhodobacterales bacterium
           Y4I]
 gi|206687338|gb|EDZ47820.1| preprotein translocase, YajC subunit [Rhodobacterales bacterium
           Y4I]
          Length = 94

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 63/90 (70%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + YFLLIRPQ++++++   M+  LRRGD +VT  G++GKV +V +
Sbjct: 3   GGAVAQFLPLILIFAIMYFLLIRPQQKKMKQHQAMVDGLRRGDQVVTQGGVIGKVAKVKE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVEIAE V+VRVV++ +++V +K+EP
Sbjct: 63  DGEIEVEIAEGVKVRVVKATIAQVLNKTEP 92


>gi|34496801|ref|NP_901016.1| transmembrane protein [Chromobacterium violaceum ATCC 12472]
 gi|34102656|gb|AAQ59021.1| probable transmembrane protein [Chromobacterium violaceum ATCC
           12472]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +A   +     A   L       V+ V+++FL++RPQ+++++   +ML  L++GD 
Sbjct: 4   ITPAFA---SGGAAPAGFDLMGFLPMIVIFVLFWFLMVRPQQKRMKETQKMLSELQKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVG+V +V +   L +EIA+NV + V R  VS    K  
Sbjct: 61  VVTQGGIVGRVSKVSE-QYLSLEIADNVEIHVQRGAVSAKLEKGT 104


>gi|322834077|ref|YP_004214104.1| preprotein translocase YajC subunit [Rahnella sp. Y9602]
 gi|321169278|gb|ADW74977.1| preprotein translocase, YajC subunit [Rahnella sp. Y9602]
          Length = 110

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP   S  SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGAP---SQGSPYSLVIMLVVFGLIFYFMILRPQQKRSKEHKKLMDSIGKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VMTTGGLIGRVTKVAETGYVVIALNDTNEVMIKRDFVAAVLPKGT 106


>gi|300715563|ref|YP_003740366.1| membrane subunit of preprotein translocase [Erwinia billingiae
           Eb661]
 gi|299061399|emb|CAX58509.1| membrane subunit of preprotein translocase [Erwinia billingiae
           Eb661]
          Length = 110

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP   S  SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAAAGAP---SQGSPYSLVIMLVVFGLIFYFMILRPQQKRGKEHKKLMDSISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V D   + + + E   V V R FV+ V  K  
Sbjct: 62  VLTTGGLVGRVTKVADTGYVAIALNETTEVVVKRDFVAAVLPKGT 106


>gi|300022793|ref|YP_003755404.1| preprotein translocase subunit YajC [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524614|gb|ADJ23083.1| preprotein translocase, YajC subunit [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 111

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 70/110 (63%), Gaps = 5/110 (4%)

Query: 1   MFT-TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MFT   YAQ+ A  +        +     ++  ++YF LIRPQ Q+ +     +  +RRG
Sbjct: 1   MFTTPAYAQAAASPMEPFGG---LLIPMILMLGIFYFFLIRPQSQRAKELRARVNAVRRG 57

Query: 60  DSIVTAAGIVGKVVRVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D+++T+ G+VGKV++V +   E+EVE+AEN+RVRVV+  + EV+SK EPV
Sbjct: 58  DTVITSGGMVGKVLKVSESSDEIEVELAENLRVRVVKGTLLEVRSKGEPV 107


>gi|58584482|ref|YP_198055.1| preprotein translocase subunit YajC [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
 gi|58418798|gb|AAW70813.1| Preprotein translocase subunit YajC [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
          Length = 144

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            + V+A   A  ++S  +P        ++ +V+YF +IRP  ++L+   +M+  ++RGD 
Sbjct: 3   ISEVFAADAASNVSSIGAPFANFVPLILICIVFYFFIIRPNHKKLKEHRKMIDQIKRGDI 62

Query: 62  IVTAAGIVGKVVRVIDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ GI+G+V +V +    L +EIA  V ++V+++ +SEV +K  
Sbjct: 63  VVTSGGIMGEVNKVDEANAQLIIEIAPKVEIKVLKTAISEVSNKET 108


>gi|262165054|ref|ZP_06032791.1| preprotein translocase subunit YajC [Vibrio mimicus VM223]
 gi|262024770|gb|EEY43438.1| preprotein translocase subunit YajC [Vibrio mimicus VM223]
          Length = 110

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +A   A          EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD
Sbjct: 3   LISVAHA---AGEGAPQGGGFEMIIMLAMFAVIFYFMIYRPQAKRVKEHKSLMSSMAKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+VG++ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 60  EVLTSGGLVGRITKISEDNAYITIELNTNNEVVIKKDFVTAVLPKGT 106


>gi|317492969|ref|ZP_07951393.1| preprotein translocase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919091|gb|EFV40426.1| preprotein translocase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 110

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP  +  +  V  +++YF+++RPQ+++ +   +++  + +GD 
Sbjct: 5   ISDAVASAGAPA---QGSPYSLVIMLVVFGLIFYFMILRPQQKRAKEHKKLMDAISKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V +   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTNGGLIGRVTKVAETGYIAIALNDTTEVIIKRDFVTAVLPKGT 106


>gi|192291547|ref|YP_001992152.1| preprotein translocase, YajC subunit [Rhodopseudomonas palustris
           TIE-1]
 gi|192285296|gb|ACF01677.1| preprotein translocase, YajC subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 146

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 67/90 (74%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S +     F ++ V+ YFL++RPQ+++++  AEM++N+RRGD+I+T+ G+VGKV +VIDD
Sbjct: 20  SMIMSLLPFALIFVIMYFLILRPQQKKVKEHAEMVKNIRRGDTIITSGGLVGKVTKVIDD 79

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
             +E E+A+ +R R +R  ++ V++K EPV
Sbjct: 80  DTVEFELADGIRARQMRQMITGVRAKGEPV 109


>gi|237749370|ref|ZP_04579850.1| preprotein translocase subunit YajC [Oxalobacter formigenes OXCC13]
 gi|229380732|gb|EEO30823.1| preprotein translocase subunit YajC [Oxalobacter formigenes OXCC13]
          Length = 108

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 55/105 (52%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ+ A     +   +       ++  V YFL+IRPQ+++ + + EM+  L  GD 
Sbjct: 3   ITNAYAQTAA--SGFSFDSMGSFLPLVLMFAVLYFLMIRPQQKKQKEQREMISALTVGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T+ GIVGK+ +V  D  L ++IAE   + + R+ +  +     
Sbjct: 61  VLTSGGIVGKITKVS-DNFLTLQIAEGTEILIQRASIVSMLPNGT 104


>gi|189501260|ref|YP_001960730.1| preprotein translocase, YajC subunit [Chlorobium phaeobacteroides
           BS1]
 gi|189496701|gb|ACE05249.1| preprotein translocase, YajC subunit [Chlorobium phaeobacteroides
           BS1]
          Length = 118

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 1   MFTTVYAQ---SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           M+ T+++    S      +A +P        ++ VV+YF LIRPQ+++ + R ++L +L+
Sbjct: 1   MYNTIFSLLLFSPQNPGGAAPNPFIQLVPLLLIFVVFYFFLIRPQQKKQKEREKVLESLK 60

Query: 58  RGDSIVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSE 100
           RGD I+T  G+ G V  +  +   + V++ +N++V   RS ++ 
Sbjct: 61  RGDKIITIGGLHGTVAGLDAEKKTVLVQLGDNLKVTFDRSAIAS 104


>gi|254440114|ref|ZP_05053608.1| preprotein translocase, YajC subunit [Octadecabacter antarcticus
           307]
 gi|198255560|gb|EDY79874.1| preprotein translocase, YajC subunit [Octadecabacter antarcticus
           307]
          Length = 93

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/90 (45%), Positives = 62/90 (68%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + YFLLIRPQ+++L+    M+  LRRGD +VTA G++GKV ++ D
Sbjct: 1   MDSIGQFIPLILIFAIMYFLLIRPQQKKLKDHQSMVAALRRGDQVVTAGGLIGKVSKIKD 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVE+AE V+VRVVRS + +V +K+EP
Sbjct: 61  DAEVEVELAEGVKVRVVRSTIGQVINKTEP 90


>gi|37527759|ref|NP_931104.1| preprotein translocase subunit YajC [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36787195|emb|CAE16275.1| Preprotein translocase YajC [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 109

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 52/90 (57%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V +V 
Sbjct: 16  QGSPYSLIIMLVVFGLIFYFMILRPQQKRTKEHRKLMDSISKGDEVMTNGGLIGRVTKVS 75

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D   + V + +   V + R FV+ V  K  
Sbjct: 76  DTGYIVVALNDTTEVTIKRDFVAAVLPKGT 105


>gi|159044409|ref|YP_001533203.1| preprotein translocase subunit [Dinoroseobacter shibae DFL 12]
 gi|157912169|gb|ABV93602.1| preprotein translocase subunit [Dinoroseobacter shibae DFL 12]
          Length = 105

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/87 (43%), Positives = 58/87 (66%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   ++  + YFLLIRPQ+++++   +M+  LRRGD IVT  G++GKV +V+DD E
Sbjct: 17  FTSFIPLILIFAIMYFLLIRPQQKKVKEHKKMVEALRRGDQIVTQGGLIGKVTKVVDDNE 76

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           ++VEIA    VRVVR  + +V +K+EP
Sbjct: 77  VKVEIATGTEVRVVRHTIQQVLTKTEP 103


>gi|144899894|emb|CAM76758.1| preprotein translocase subunit [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 125

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/108 (43%), Positives = 70/108 (64%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF +      A +       +E      ++ VV+YFL+IRPQ+++++   EML  LRRGD
Sbjct: 1   MFVSPAYAQAAGSAGGIAGGVEAFLPLVLIFVVFYFLMIRPQQKRMKVHKEMLAALRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +V A+GI+G V +V  D E++VEIA+ V+VRVVRS + EV +K+EPV
Sbjct: 61  RVVLASGIMGLVTKVTSDTEVQVEIADGVKVRVVRSAIQEVVAKTEPV 108


>gi|299134930|ref|ZP_07028121.1| preprotein translocase, YajC subunit [Afipia sp. 1NLS2]
 gi|298589907|gb|EFI50111.1| preprotein translocase, YajC subunit [Afipia sp. 1NLS2]
          Length = 114

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 72/107 (67%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF T      A A     S L     F ++ V+ YFL++RPQ+++ +  A +++N+RRGD
Sbjct: 1   MFITPAFAQAAGAAGDTNSMLMSLLPFAMIFVIMYFLILRPQQRKAKEHANLVKNIRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           ++VT+ G+VGKV +V+DD ++E+E+++ VR+R +R  ++ V+SK EP
Sbjct: 61  TVVTSGGLVGKVTKVVDDEQIEMEVSDGVRIRQMRQMIATVRSKGEP 107


>gi|42520396|ref|NP_966311.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|99034348|ref|ZP_01314377.1| hypothetical protein Wendoof_01000823 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|42410134|gb|AAS14245.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 123

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + + V+A       +S  +         ++ VV+YFL+IRPQ+++L+   +M+  ++RGD
Sbjct: 2   LISEVFAADATSNTSSIGASFASFIPLILIFVVFYFLIIRPQQKKLKEHRKMIDQIKRGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
           +++T+ GI+G+V +V +      +EIA  V ++V++S +SEV SK  
Sbjct: 62  TVITSGGIIGEVNKVDEANAQFIIEIAPKVEIKVLKSAISEVLSKET 108


>gi|56461249|ref|YP_156530.1| preprotein translocase subunit YajC [Idiomarina loihiensis L2TR]
 gi|56180259|gb|AAV82981.1| Preprotein translocase subunit YajC [Idiomarina loihiensis L2TR]
          Length = 111

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 59/106 (55%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++ YAQ      +     +E+  +  + A+++YF++ RPQ +++++  E++  L +GD 
Sbjct: 5   ISSAYAQDAGGQGSGG---MELIFMLVMFALIFYFMIYRPQAKRVKQHKELMGALSKGDE 61

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VGK+ +V +D   L + + + + V + +  V+ V  K  
Sbjct: 62  VLTQGGLVGKITKVSEDKDFLVIALTDELEVTIQKGSVTSVLPKGT 107


>gi|221133851|ref|ZP_03560156.1| preprotein translocase subunit YajC [Glaciecola sp. HTCC2999]
          Length = 112

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 59/106 (55%), Gaps = 3/106 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +T +AQ+   +       +EM  +  V  +++YFLL RPQ ++++    ++ +L +GD 
Sbjct: 5   ISTAHAQTAGGSAQGGG--IEMLIMLAVFGLIFYFLLYRPQAKRVKEHKNLVASLSKGDE 62

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VGK+ +V D+   +E+ + E   + V ++ V+ V  K  
Sbjct: 63  VLTQGGLVGKITKVTDEKDFIEIALNETNDIIVQKASVTAVLPKGT 108


>gi|117620253|ref|YP_856272.1| preprotein translocase, YajC subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561660|gb|ABK38608.1| preprotein translocase, YajC subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 111

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YA+   P        +EM  +  V  +++YF++ RPQ ++ +    ++ +L +GD
Sbjct: 3   IISKAYAEGAVPGAQGGG--MEMIIMLAVFGLIFYFMIYRPQAKRAKDHRNLMSSLSKGD 60

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
            ++T+ G+VGK+ +V  D   L + + +  +V + R FVS V  K 
Sbjct: 61  EVLTSGGLVGKIAKVSADSEYLVLALNDQTQVTIKRDFVSAVLPKG 106


>gi|54307939|ref|YP_128959.1| preprotein translocase subunit YajC [Photobacterium profundum SS9]
 gi|46912365|emb|CAG19157.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 111

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 52/100 (52%), Gaps = 1/100 (1%)

Query: 8   QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAG 67
            + A         +++  +  + AV++YF++ RPQ ++ +    ++  + +GD ++T  G
Sbjct: 8   ANAAAEGAPQGGSMQLFIMLGLFAVIFYFMIYRPQAKRAKEHKTLMSAMGKGDEVLTNGG 67

Query: 68  IVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++GK+ +V  +   + + + +N  V + + FV+ V  K  
Sbjct: 68  LLGKITKVSAETDYIVIALNDNNEVTIKKDFVTAVLPKGT 107


>gi|270263542|ref|ZP_06191811.1| hypothetical protein SOD_e01660 [Serratia odorifera 4Rx13]
 gi|293392576|ref|ZP_06636896.1| preprotein translocase [Serratia odorifera DSM 4582]
 gi|270042426|gb|EFA15521.1| hypothetical protein SOD_e01660 [Serratia odorifera 4Rx13]
 gi|291424978|gb|EFE98187.1| preprotein translocase [Serratia odorifera DSM 4582]
          Length = 110

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + APA     SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVASAGAPA---QGSPYSLIIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V D   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTTGGLIGRVTKVADTGIIAIALNDTTEVMIKRDFVAAVLPKGT 106


>gi|89068236|ref|ZP_01155646.1| preprotein translocase, YajC subunit [Oceanicola granulosus
           HTCC2516]
 gi|89046153|gb|EAR52211.1| preprotein translocase, YajC subunit [Oceanicola granulosus
           HTCC2516]
          Length = 97

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 40/91 (43%), Positives = 64/91 (70%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
               +       ++  + YFLLIRPQ+++L++  EM++ LRRGD +VT  G++GKV +V 
Sbjct: 2   QGGAIAQFIPLILIFAIMYFLLIRPQQKKLKQHQEMVKALRRGDQVVTQGGLIGKVAKVK 61

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           DD E+EVE+++ V VRVVRS +++V +K+EP
Sbjct: 62  DDNEIEVELSQGVTVRVVRSTIAQVINKTEP 92


>gi|292490994|ref|YP_003526433.1| preprotein translocase subunit YajC [Nitrosococcus halophilus Nc4]
 gi|291579589|gb|ADE14046.1| preprotein translocase, YajC subunit [Nitrosococcus halophilus Nc4]
          Length = 111

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 58/105 (55%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +AQ + P+  +  S      +F  + +V+Y L IRP+ ++ + R  ML ++ +GD 
Sbjct: 5   ITEAWAQ-NGPSPEATGSFWVPLLIFSTIFLVYYLLAIRPRLKRHKERLRMLASVSKGDE 63

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           IVT  G+ G++++V  D  L +E+ E + V+V +  VS V  K  
Sbjct: 64  IVTNGGLWGRILKV-GDNFLLLELTEGIEVKVEKGAVSRVLPKGT 107


>gi|153824530|ref|ZP_01977197.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|261212158|ref|ZP_05926444.1| preprotein translocase subunit YajC [Vibrio sp. RC341]
 gi|262402874|ref|ZP_06079435.1| preprotein translocase subunit YajC [Vibrio sp. RC586]
 gi|149741748|gb|EDM55777.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|260838766|gb|EEX65417.1| preprotein translocase subunit YajC [Vibrio sp. RC341]
 gi|262351656|gb|EEZ00789.1| preprotein translocase subunit YajC [Vibrio sp. RC586]
          Length = 110

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +A   A          EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD
Sbjct: 3   LISVAHA---AGEGAPQGGGFEMIIMLAMFAVIFYFMIYRPQAKRVKEHKSLMSSMAKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+VG++ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 60  EVLTSGGLVGRITKIAEDNAYITIELNTNNEVVIKKDFVTAVLPKGT 106


>gi|319407533|emb|CBI81183.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 152

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ  A + TS  +       F ++  + YFL+IRPQR Q+++R EML  +RRGD
Sbjct: 2   LVTNAYAQ--AVSHTSNGTSFITFVPFILIFAIMYFLIIRPQRAQMKKRQEMLNAVRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +++T  GI+GKV +V D+  ELEVEI+E +R+RV+RS +++V+ K EP+
Sbjct: 60  TVLTGGGIIGKVTKVYDESGELEVEISEGIRIRVIRSTLADVRIKGEPL 108


>gi|89053574|ref|YP_509025.1| protein translocase subunit yajC [Jannaschia sp. CCS1]
 gi|88863123|gb|ABD54000.1| protein translocase subunit yajC [Jannaschia sp. CCS1]
          Length = 93

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 62/87 (71%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   ++ V+ YF LIRPQ+++++    M+  LRRGD +VT  G++GK+ +V D+ E
Sbjct: 4   FGQVVPLILILVIMYFFLIRPQQKKVKEHQAMVEALRRGDEVVTQGGLIGKITKVKDETE 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +EVEIA++V++RV+R  +++V+SK+EP
Sbjct: 64  VEVEIAKDVKIRVLRPTIAQVRSKTEP 90


>gi|262274806|ref|ZP_06052617.1| preprotein translocase subunit YajC [Grimontia hollisae CIP 101886]
 gi|262221369|gb|EEY72683.1| preprotein translocase subunit YajC [Grimontia hollisae CIP 101886]
          Length = 109

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 60/106 (56%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A ++          +++  +  + AV++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 3   ISQAHAAAEGAPQGGG---MQLFIMLGLFAVIFYFMIYRPQAKRVKEHKNLMASMGKGDE 59

Query: 62  IVTAAGIVGKVVRVIDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VGK+ ++ DD + + + +++N  V + + FV+ V  K  
Sbjct: 60  VLTGGGLVGKITKISDDNDFIVIALSDNNEVTIKKDFVTAVLPKGT 105


>gi|88606984|ref|YP_505638.1| preprotein translocase, YajC subunit [Anaplasma phagocytophilum HZ]
 gi|88598047|gb|ABD43517.1| preprotein translocase, YajC subunit [Anaplasma phagocytophilum HZ]
          Length = 124

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 63/108 (58%), Gaps = 5/108 (4%)

Query: 2   FTTVYAQSDAPAITSATS---PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRR 58
           FT VYA   + A   A      +       ++  V+YFL+IRPQ+++L+   ++L +L+R
Sbjct: 4   FTDVYAADPSTAAAPAAGIGASIAGFIPLVLIFGVFYFLVIRPQQKKLKEHNKLLESLKR 63

Query: 59  GDSIVTAAGIVGKVVRVIDDL--ELEVEIAENVRVRVVRSFVSEVQSK 104
           GD +V A G+ G + +V  +    L +EI+  V ++++RS VSEV +K
Sbjct: 64  GDKVVAAGGLYGTITKVDSNNPSVLHIEISNGVEIKILRSSVSEVLNK 111


>gi|83943027|ref|ZP_00955487.1| preprotein translocase, YajC subunit [Sulfitobacter sp. EE-36]
 gi|83954201|ref|ZP_00962921.1| preprotein translocase, YajC subunit [Sulfitobacter sp. NAS-14.1]
 gi|83841238|gb|EAP80408.1| preprotein translocase, YajC subunit [Sulfitobacter sp. NAS-14.1]
 gi|83846035|gb|EAP83912.1| preprotein translocase, YajC subunit [Sulfitobacter sp. EE-36]
          Length = 92

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 65/87 (74%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           ++      ++  + YFLLIRPQ+++++    M+  LRRGD +VTA G++GKVV+V DD E
Sbjct: 4   IQQFVPLILIFAIMYFLLIRPQQKKVKEHKAMVDGLRRGDQVVTAGGLIGKVVKVKDDGE 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           LEVE+A+NV+VRVV+S ++ V SK+EP
Sbjct: 64  LEVELADNVKVRVVQSTIATVVSKTEP 90


>gi|157369305|ref|YP_001477294.1| preprotein translocase subunit YajC [Serratia proteamaculans 568]
 gi|157321069|gb|ABV40166.1| preprotein translocase, YajC subunit [Serratia proteamaculans 568]
          Length = 110

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + AP   S  SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVASAGAP---SQGSPYSLIIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V D   + + + +   V + R FV+ V  K  
Sbjct: 62  VLTTGGLIGRVTKVADTGIIAIALNDTTEVMIKRDFVAAVLPKGT 106


>gi|270157328|ref|ZP_06185985.1| preprotein translocase YajC subunit [Legionella longbeachae D-4968]
 gi|289164277|ref|YP_003454415.1| SecYEG protein translocase auxillary subunit [Legionella
           longbeachae NSW150]
 gi|269989353|gb|EEZ95607.1| preprotein translocase YajC subunit [Legionella longbeachae D-4968]
 gi|288857450|emb|CBJ11278.1| SecYEG protein translocase auxillary subunit [Legionella
           longbeachae NSW150]
          Length = 111

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A +     T          +   + V++YF+LIRPQ ++ +   +++  L++GD 
Sbjct: 5   ISDAMA-AAGTTPTPQADGTFSLIMIAAIFVLFYFMLIRPQNKRAKEHRDLISKLKKGDE 63

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           I+T+ GI+ KVV + D+  +++ +AE V + + R  VS V  K  
Sbjct: 64  IITSGGILAKVVSL-DEQYIKISLAEGVEINLQRGAVSAVLPKGT 107


>gi|330446691|ref|ZP_08310343.1| preprotein translocase, YajC subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328490882|dbj|GAA04840.1| preprotein translocase, YajC subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 111

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 55/106 (51%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A   A         +++  +  + AV++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 5   ISQAHA---AAEGAPQGGSMQLFIMLGLFAVIFYFMIYRPQAKRVKEHKALMSSMGKGDE 61

Query: 62  IVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G++ +V  D   + + +  N  V + + FV+ V  K  
Sbjct: 62  VMTNGGLLGRITKVSADSDYIVIALNNNTEVTIKKDFVTAVLPKGT 107


>gi|78485676|ref|YP_391601.1| preprotein translocase, YajC subunit [Thiomicrospira crunogena
           XCL-2]
 gi|78363962|gb|ABB41927.1| protein translocase subunit yajC [Thiomicrospira crunogena XCL-2]
          Length = 111

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 59/105 (56%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A+  A A     S  E      +L VV+YFLLIRPQ+++++   ++++ L +G  
Sbjct: 5   ISDAMAEGGAAA---QGSGFEALLPLILLFVVFYFLLIRPQQKKVKEHKKLVQALGKGAE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G+ GK+  + D+  +++E+A+NV V++ R  V+    K  
Sbjct: 62  VVTYGGLAGKIREL-DENFVDLEVADNVVVKIERQNVARELPKGT 105


>gi|58699002|ref|ZP_00373851.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630158|ref|YP_002726949.1| preprotein translocase, YajC subunit [Wolbachia sp. wRi]
 gi|58534478|gb|EAL58628.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592139|gb|ACN95158.1| preprotein translocase, YajC subunit [Wolbachia sp. wRi]
          Length = 123

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + + V+A       +S  +         ++ VV+YFL+IRPQ+++L+    M+  ++RGD
Sbjct: 2   LISEVFAADATSNTSSIGASFASFTPLILIFVVFYFLIIRPQQKKLKEHRRMIDQIKRGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
           +++T+ GI+G+V +V +      +EIA  V ++V++S +SEV SK  
Sbjct: 62  TVITSGGIIGEVNKVDEANAQFIIEIAPKVEIKVLKSAISEVLSKET 108


>gi|94501957|ref|ZP_01308465.1| YajC [Oceanobacter sp. RED65]
 gi|94425899|gb|EAT10899.1| YajC [Oceanobacter sp. RED65]
          Length = 120

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           F  V A ++  A       +E         +++YFLL RPQ ++ +    ++ +L +G  
Sbjct: 11  FAPVSAMAEGQAAPQGAGGIEQLIFLGGFVLIFYFLLWRPQSKRAKEHKNLIASLEKGSE 70

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ GIVG++ +V ++  + +++A++V + V +  V+    K  
Sbjct: 71  VVTSGGIVGRITKVTEEF-VVLKVADSVEMPVQKQAVAAALPKGT 114


>gi|119358226|ref|YP_912870.1| protein translocase subunit yajC [Chlorobium phaeobacteroides DSM
           266]
 gi|119355575|gb|ABL66446.1| protein translocase subunit yajC [Chlorobium phaeobacteroides DSM
           266]
          Length = 117

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 57/98 (58%), Gaps = 1/98 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
             PA     +P        ++ +V+YF +IRPQ+++ + R ++L +L+RGD +VT  G+ 
Sbjct: 12  SPPAGGQTPNPFIQLVPLVLIFIVFYFFMIRPQQKKQKDREKVLDSLKRGDKVVTIGGVH 71

Query: 70  GKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           G V  +  +   + V+++ENV+++  R+ V+ ++ +  
Sbjct: 72  GTVAGIDTEKKTVLVQVSENVKIKFDRTAVANIEKQET 109


>gi|312795156|ref|YP_004028078.1| protein translocase subunit YajC [Burkholderia rhizoxinica HKI 454]
 gi|312166931|emb|CBW73934.1| Protein translocase subunit YajC [Burkholderia rhizoxinica HKI 454]
          Length = 166

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            ++  G F ++  V YF +IRPQ ++ +    ML  + +GD ++T+ GIVGKV +V +  
Sbjct: 77  FIQTYGFFILMIAVLYFFMIRPQMKRQKEHRNMLAAMTKGDEVLTSGGIVGKVTKVGEA- 135

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + VE+++ V V V +S VS +  K  
Sbjct: 136 YVGVELSDGVEVTVQKSAVSAILPKGT 162


>gi|163853626|ref|YP_001641669.1| preprotein translocase, YajC subunit [Methylobacterium extorquens
           PA1]
 gi|218532485|ref|YP_002423301.1| preprotein translocase, YajC subunit [Methylobacterium
           chloromethanicum CM4]
 gi|240141048|ref|YP_002965528.1| preprotein translocase, auxillary membrane component (General
           Secretory Pathway), YajC subunit [Methylobacterium
           extorquens AM1]
 gi|254563562|ref|YP_003070657.1| preprotein translocase, auxillary membrane component
           [Methylobacterium extorquens DM4]
 gi|163665231|gb|ABY32598.1| preprotein translocase, YajC subunit [Methylobacterium extorquens
           PA1]
 gi|218524788|gb|ACK85373.1| preprotein translocase, YajC subunit [Methylobacterium
           chloromethanicum CM4]
 gi|240011025|gb|ACS42251.1| preprotein translocase, auxillary membrane component (General
           Secretory Pathway), YajC subunit [Methylobacterium
           extorquens AM1]
 gi|254270840|emb|CAX26845.1| preprotein translocase, auxillary membrane component (General
           Secretory Pathway), YajC subunit [Methylobacterium
           extorquens DM4]
          Length = 110

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M T  +AQ       S          F ++ V+ YFL++RPQ+++L+    M++N+RR D
Sbjct: 1   MITPAFAQ--GVGAGSGADVALQFVPFVLIFVIMYFLILRPQQRRLKDHQNMVKNVRRED 58

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +IVT  G+VG+V +V DD  E+EVEIA NVRV+VVRS +SEV+ K  PV
Sbjct: 59  TIVTTGGLVGRVTKVADDATEIEVEIAPNVRVKVVRSMISEVRVKGAPV 107


>gi|294140346|ref|YP_003556324.1| preprotein translocase subunit YajC [Shewanella violacea DSS12]
 gi|293326815|dbj|BAJ01546.1| preprotein translocase, YajC subunit [Shewanella violacea DSS12]
          Length = 110

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++ +A       T A   +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD 
Sbjct: 3   ISSAFAADA--PTTGAGGTMELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMGSLSKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKS 105
           I+T+ GI+GK+ ++ ++   + + I E   + + + +++ V  K 
Sbjct: 61  ILTSGGILGKIAKISEENDYVLLAINETSEITIKKDYIAAVLPKG 105


>gi|145299554|ref|YP_001142395.1| preprotein translocase, YajC subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142852326|gb|ABO90647.1| preprotein translocase, YajC subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 111

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YA+   P        ++M  +  V  +++YF++ RPQ ++ +    ++ +L +GD
Sbjct: 3   IISKAYAEGAVPGAQGGG--MKMIIMLAVFGLIFYFMIYRPQAKRAKDHRNLMSSLAKGD 60

Query: 61  SIVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            ++T+ G+VGK+ +V  D   + + + +  +V + R FVS V  K 
Sbjct: 61  EVLTSGGLVGKIAKVSADSEYIVLSLNDQTQVTIKRDFVSAVLPKG 106


>gi|300721775|ref|YP_003711053.1| preprotein translocase auxillary membrane protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297628270|emb|CBJ88831.1| preprotein translocase, auxillary membrane component (General
           Secretory Pathway) [Xenorhabdus nematophila ATCC 19061]
          Length = 112

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 54/92 (58%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
            S  +P  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T+ G+VG+V +
Sbjct: 17  QSQGNPYSLIIMLVVFGLIFYFMILRPQQKRTKEHKKLMDSISKGDEVLTSGGLVGRVTK 76

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           V +   + + + E   + V R FV+ V  K  
Sbjct: 77  VSETGYVVIALNETTEITVKRDFVAAVLPKGT 108


>gi|121998477|ref|YP_001003264.1| preprotein translocase subunit YajC [Halorhodospira halophila SL1]
 gi|121589882|gb|ABM62462.1| protein translocase subunit yajC [Halorhodospira halophila SL1]
          Length = 123

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ            L       +L  V+YFLLIRPQRQ++++  +M+  L  GD 
Sbjct: 7   ISPAHAQ----QAGGGGDMLFFLIFTVLLVAVFYFLLIRPQRQRMKQHQQMVEGLAEGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ G +G++ R+ +   + VE+A+ V   V R  +  V  K  
Sbjct: 63  VVTSGGELGRITRLGE-QFVRVEVAKGVEWSVKRDMIGHVLPKGT 106


>gi|196232268|ref|ZP_03131122.1| preprotein translocase, YajC subunit [Chthoniobacter flavus
           Ellin428]
 gi|196223636|gb|EDY18152.1| preprotein translocase, YajC subunit [Chthoniobacter flavus
           Ellin428]
          Length = 110

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 1   MFTTVYAQSDAPA-ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           M ++++      A   +  SPL     F  + V++YFL+IRPQ ++ +  + ++  L+ G
Sbjct: 1   MTSSIFLTLADTATPAAGPSPLSSIVPFICVGVIFYFLIIRPQNKRQKELSSLVSTLKTG 60

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           D +VT++GI G +  V +   L ++IA+NV++ + +S ++ V
Sbjct: 61  DKVVTSSGIHGIIANVKEGSTLILKIADNVKIELDKSAIASV 102


>gi|254486748|ref|ZP_05099953.1| preprotein translocase, YajC subunit [Roseobacter sp. GAI101]
 gi|214043617|gb|EEB84255.1| preprotein translocase, YajC subunit [Roseobacter sp. GAI101]
          Length = 92

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/90 (47%), Positives = 64/90 (71%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              ++      ++  + YFLLIRPQ+++++    M+  LRRGD +VT  G++GKVV+V D
Sbjct: 1   MQGIQQFVPLILIFAIMYFLLIRPQQKKVKEHKAMVDGLRRGDQVVTQGGLIGKVVKVKD 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D ELEVE+AENV+VRVV+S ++ V SK+EP
Sbjct: 61  DGELEVELAENVKVRVVQSTIATVVSKTEP 90


>gi|154253475|ref|YP_001414299.1| preprotein translocase subunit YajC [Parvibaculum lavamentivorans
           DS-1]
 gi|154157425|gb|ABS64642.1| preprotein translocase, YajC subunit [Parvibaculum lavamentivorans
           DS-1]
          Length = 104

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/96 (48%), Positives = 70/96 (72%), Gaps = 1/96 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
               A+  +     F  L  + YFL++RPQ+++++   EM+ N+RRGD +VTA G++GKV
Sbjct: 2   GGGGASEFMIQLFPFIALFAIMYFLVLRPQQRRVKLHREMVTNVRRGDVVVTAGGLIGKV 61

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +V DDLE+ VEIA+NVRVRVV+S +++V+SKSEPV
Sbjct: 62  TKV-DDLEVTVEIADNVRVRVVKSTLTDVRSKSEPV 96


>gi|253574937|ref|ZP_04852277.1| preprotein translocase subunit [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251845983|gb|EES73991.1| preprotein translocase subunit [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 102

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/101 (34%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 6   YAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTA 65
           + Q  A   T A S + M   F ++  V+YFLLIRPQ+++ Q+R  ML  L++GD IVT 
Sbjct: 2   FFQYAAQQTTGANSLISMIIPFVIMIAVFYFLLIRPQKKKQQQRNSMLSALKKGDKIVTI 61

Query: 66  AGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            G+ G ++ + DD  + + + +  ++   RS +S    +SE
Sbjct: 62  GGLHGTIMELTDD-TVVLRVNDVTKLTFDRSAISHTIKESE 101


>gi|319899186|ref|YP_004159279.1| hypothetical protein BARCL_1027 [Bartonella clarridgeiae 73]
 gi|319403150|emb|CBI76708.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 152

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 50/109 (45%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ  A + TS  +       F ++  + YFL+IRPQR Q+++R EML  +RRGD
Sbjct: 2   LVTNAYAQ--AISDTSNGASFITFVPFILIFAIMYFLIIRPQRAQMKKRQEMLNAVRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           ++VT  GI+GKV +V D   ELEVEI E +R+RV+RS +++V+ K EP+
Sbjct: 60  TVVTGGGILGKVTKVYDGSGELEVEIGEGIRIRVIRSTLADVRVKGEPL 108


>gi|115524914|ref|YP_781825.1| preprotein translocase, YajC subunit [Rhodopseudomonas palustris
           BisA53]
 gi|115518861|gb|ABJ06845.1| protein translocase subunit yajC [Rhodopseudomonas palustris
           BisA53]
          Length = 145

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 67/90 (74%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L     F ++ V+ YFL++RPQ+++++  AEM++N+RRGD+I+T+ G+VGKV +VIDD
Sbjct: 19  SMLMSLLPFALIFVIMYFLILRPQQKKVKEHAEMVKNVRRGDTIITSGGLVGKVTKVIDD 78

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
             +E E+A+ +R R +R  ++ V++K EP+
Sbjct: 79  DVVEFEVADGIRARQMRQMITGVRAKGEPL 108


>gi|163868045|ref|YP_001609249.1| preprotein translocase YajC [Bartonella tribocorum CIP 105476]
 gi|161017696|emb|CAK01254.1| preprotein translocase YajC [Bartonella tribocorum CIP 105476]
          Length = 153

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 68/108 (62%), Gaps = 3/108 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ       S       A    ++  + YF +IRPQR Q+++R EML  +RRGD+
Sbjct: 3   ITNAYAQGAG--DVSGGISFVGAIPLILIFAIMYFFIIRPQRAQMKKRQEMLDAVRRGDT 60

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           ++T  GI+GKV +V ++  ELEVEI E++ +RV+RS +++V+ K EP+
Sbjct: 61  VITGGGIIGKVTKVHNESGELEVEIGESMNIRVLRSTLADVRVKGEPI 108


>gi|145589970|ref|YP_001156567.1| preprotein translocase, YajC subunit [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048376|gb|ABP35003.1| protein translocase subunit yajC [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ  APA    T  L       ++  V YF++IRPQ ++ +    ML  L  GD 
Sbjct: 3   ISNAFAQ--APAGGVDTGGLMSFLPLILMFAVLYFIMIRPQMKRQKETKAMLEALAVGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GI+GKV   + D  + VEI+    V++ +  ++ V  K  
Sbjct: 61  VVTVGGILGKV-SALKDQVVTVEISAGTEVQLQKGAITTVLPKGT 104


>gi|162147959|ref|YP_001602420.1| hypothetical protein GDI_2175 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542576|ref|YP_002274805.1| preprotein translocase subunit YajC [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786536|emb|CAP56118.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530253|gb|ACI50190.1| preprotein translocase, YajC subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 126

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITS-ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           + T  YAQ+        +   +     +  + V++YF+LIRPQ+Q+ ++    L +LRRG
Sbjct: 8   LVTPAYAQTAGGEGGLLSAGGMMSILPYVAMFVIFYFILIRPQQQKQKQLRAQLASLRRG 67

Query: 60  DSIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
           D ++TA GIV  V +V DD  E+EVEIA NVRV V+R  ++ V S S
Sbjct: 68  DRVLTAGGIVATVQKVRDDSNEMEVEIAPNVRVTVLRETITSVVSSS 114


>gi|193213611|ref|YP_001999564.1| preprotein translocase, YajC subunit [Chlorobaculum parvum NCIB
           8327]
 gi|193087088|gb|ACF12364.1| preprotein translocase, YajC subunit [Chlorobaculum parvum NCIB
           8327]
          Length = 118

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 61/110 (55%), Gaps = 4/110 (3%)

Query: 1   MFTTVYAQ---SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           M+ T+ A    +       A +P        ++ VV+YF +IRPQ+++ + R ++L +++
Sbjct: 1   MYDTILALMLFAPPTTGGPAPNPFVQLVPLVLIFVVFYFFMIRPQQKKQKEREKLLDDIK 60

Query: 58  RGDSIVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           RGD IVT  GI G V  +  +   + V++A+N++++  RS ++  + +  
Sbjct: 61  RGDKIVTIGGIHGTVAGIDTEKKTVLVQVADNLKIKFERSAIANTEKQET 110


>gi|27363912|ref|NP_759440.1| preprotein translocase subunit YajC [Vibrio vulnificus CMCP6]
 gi|37678931|ref|NP_933540.1| preprotein translocase subunit YajC [Vibrio vulnificus YJ016]
 gi|320157293|ref|YP_004189672.1| preprotein translocase subunit YajC [Vibrio vulnificus MO6-24/O]
 gi|27360029|gb|AAO08967.1| preprotein translocase, YajC subunit [Vibrio vulnificus CMCP6]
 gi|37197673|dbj|BAC93511.1| preprotein translocase, YajC subunit [Vibrio vulnificus YJ016]
 gi|319932605|gb|ADV87469.1| preprotein translocase subunit YajC [Vibrio vulnificus MO6-24/O]
          Length = 109

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A ++           EM  +  +  V++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 3   ISQAHAAAEGAQQGG---MFEMLIMLGMFGVIFYFMIYRPQAKRVKEHKSLMASMGKGDE 59

Query: 62  IVTAAGIVGKVVRVIDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VGK+ ++ +D + + +E+  N  V + + FV+ V  K  
Sbjct: 60  VLTNGGLVGKITKIAEDNDFVTIELNPNNEVVIKKDFVTAVLPKGT 105


>gi|94311877|ref|YP_585087.1| preprotein translocase subunit YajC [Cupriavidus metallidurans
           CH34]
 gi|93355729|gb|ABF09818.1| preprotein translocase auxiliary subunit YajC transmembrane
           [Cupriavidus metallidurans CH34]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ+    I      L       ++  V +F++IRPQ ++ +    M+  L + D 
Sbjct: 3   ISNAFAQTA--GIGGGAGGLMSFLPIILMFAVLWFIMIRPQMKRQKETKAMMEALAKNDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +VTA GI+G+V +V +   + +E+AE   + V ++ V+ V  K 
Sbjct: 61  VVTAGGILGRVTKVNE-NYVTLEVAEGTEITVQKNAVTTVLPKG 103


>gi|77359287|ref|YP_338862.1| preprotein translocase subunit YajC [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874198|emb|CAI85419.1| putative preprotein translocase IISP family, membrane subunit
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 111

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A + + +       +EM  +  +  +V+YFL+ RPQ ++++    ++  + +GD 
Sbjct: 5   ISNAHASTGSASAGGG---MEMLIMLAIFGLVFYFLIYRPQAKRVKEHKSLMSAMAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VGK+V++ DD   + + + E   V V +S V+ V  K  
Sbjct: 62  VLTQGGLVGKIVKIADDKDFVVISLNEQAEVTVQKSAVTAVLPKGT 107


>gi|152980538|ref|YP_001352042.1| preprotein translocase subunit YajC [Janthinobacterium sp.
           Marseille]
 gi|151280615|gb|ABR89025.1| preprotein translocase subunit YajC [Janthinobacterium sp.
           Marseille]
          Length = 107

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA   A A       L       ++ VV YFL+IRPQ ++ +    M+  + RGD 
Sbjct: 3   ISNAYA---ATAAGGVLGNLTQFVPIILMFVVLYFLMIRPQMKRQKEHKAMIEAVTRGDE 59

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ G++GK+ +V  D+ L +E+ +   + + +S V+ +  K  
Sbjct: 60  VVTSGGVLGKITKVS-DVYLSLEVQDGTEIVIQKSAVTTLLPKGT 103


>gi|194290674|ref|YP_002006581.1| preprotein translocase subunit YajC [Cupriavidus taiwanensis LMG
           19424]
 gi|193224509|emb|CAQ70520.1| protein translocase auxillary subunit [Cupriavidus taiwanensis LMG
           19424]
          Length = 108

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +AQ+       A   L       ++  V +F++IRPQ ++ +    ML  L + D
Sbjct: 2   LISNAFAQTA--GAGGAAGGLMSFLPIILMFGVLWFIMIRPQMKRQKEAKAMLEALAKND 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +VTA GI+G+V +V  D  + +EIAE   + V ++ V+ V  K 
Sbjct: 60  EVVTAGGILGRVTKVT-DQYVSLEIAEGTEITVQKNAVTTVLPKG 103


>gi|83858676|ref|ZP_00952198.1| Putative preprotein translocase subunit YajC [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853499|gb|EAP91351.1| Putative preprotein translocase subunit YajC [Oceanicaulis
           alexandrii HTCC2633]
          Length = 122

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           + + A       +     F ++ VV+YFLLIRPQ+Q+ +   EM+  LR+GD +VT+ G+
Sbjct: 14  AASGAQGGLGYMIMQFAPFILIFVVFYFLLIRPQQQKAKAHREMVEGLRKGDEVVTSGGM 73

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +GKV RV  D E  VE+AE VRV+V++  + EV++++EP
Sbjct: 74  IGKVTRVA-DAEATVELAEGVRVKVLKHTIMEVRTRTEP 111


>gi|15640761|ref|NP_230391.1| preprotein translocase subunit YajC [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121591447|ref|ZP_01678723.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121729721|ref|ZP_01682162.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147673510|ref|YP_001216227.1| preprotein translocase subunit YajC [Vibrio cholerae O395]
 gi|153217319|ref|ZP_01951070.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153802820|ref|ZP_01957406.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|153818845|ref|ZP_01971512.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153829412|ref|ZP_01982079.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|227080921|ref|YP_002809472.1| hypothetical protein VCM66_0700 [Vibrio cholerae M66-2]
 gi|229505644|ref|ZP_04395154.1| preprotein translocase subunit YajC [Vibrio cholerae BX 330286]
 gi|229513119|ref|ZP_04402585.1| preprotein translocase subunit YajC [Vibrio cholerae TMA 21]
 gi|229517806|ref|ZP_04407250.1| preprotein translocase subunit YajC [Vibrio cholerae RC9]
 gi|229523435|ref|ZP_04412842.1| preprotein translocase subunit YajC [Vibrio cholerae TM 11079-80]
 gi|229525388|ref|ZP_04414793.1| preprotein translocase subunit YajC [Vibrio cholerae bv. albensis
           VL426]
 gi|229530128|ref|ZP_04419518.1| preprotein translocase subunit YajC [Vibrio cholerae 12129(1)]
 gi|254225007|ref|ZP_04918621.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|254285460|ref|ZP_04960424.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|262161317|ref|ZP_06030428.1| preprotein translocase subunit YajC [Vibrio cholerae INDRE 91/1]
 gi|262168809|ref|ZP_06036504.1| preprotein translocase subunit YajC [Vibrio cholerae RC27]
 gi|262190475|ref|ZP_06048726.1| preprotein translocase subunit YajC [Vibrio cholerae CT 5369-93]
 gi|297581141|ref|ZP_06943065.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298499125|ref|ZP_07008932.1| preprotein translocase subunit YajC [Vibrio cholerae MAK 757]
 gi|9655187|gb|AAF93907.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121546698|gb|EAX56877.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121628538|gb|EAX61021.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|124113660|gb|EAY32480.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124121645|gb|EAY40388.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|125622394|gb|EAZ50714.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|126510627|gb|EAZ73221.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|146315393|gb|ABQ19932.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|148875132|gb|EDL73267.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|150424322|gb|EDN16259.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227008809|gb|ACP05021.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227012566|gb|ACP08776.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229333902|gb|EEN99388.1| preprotein translocase subunit YajC [Vibrio cholerae 12129(1)]
 gi|229338969|gb|EEO03986.1| preprotein translocase subunit YajC [Vibrio cholerae bv. albensis
           VL426]
 gi|229339798|gb|EEO04813.1| preprotein translocase subunit YajC [Vibrio cholerae TM 11079-80]
 gi|229344521|gb|EEO09495.1| preprotein translocase subunit YajC [Vibrio cholerae RC9]
 gi|229350012|gb|EEO14966.1| preprotein translocase subunit YajC [Vibrio cholerae TMA 21]
 gi|229357867|gb|EEO22784.1| preprotein translocase subunit YajC [Vibrio cholerae BX 330286]
 gi|262022927|gb|EEY41633.1| preprotein translocase subunit YajC [Vibrio cholerae RC27]
 gi|262029067|gb|EEY47720.1| preprotein translocase subunit YajC [Vibrio cholerae INDRE 91/1]
 gi|262033647|gb|EEY52136.1| preprotein translocase subunit YajC [Vibrio cholerae CT 5369-93]
 gi|297534457|gb|EFH73294.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297543458|gb|EFH79508.1| preprotein translocase subunit YajC [Vibrio cholerae MAK 757]
 gi|327483529|gb|AEA77936.1| Preprotein translocase subunit YajC [Vibrio cholerae LMA3894-4]
          Length = 110

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 57/107 (53%), Gaps = 4/107 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +A   A          EM  +  + AV++YF++ RPQ ++++    ++  + +GD
Sbjct: 3   LISVAHA---AGEGAPQGGGFEMIIMLAMFAVIFYFMIYRPQAKRVKEHKNLMAAMAKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+VG++ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 60  EVLTSGGLVGRITKIAEDNAYITIELNTNNEVVIKKDFVTAVLPKGT 106


>gi|92114951|ref|YP_574879.1| protein translocase subunit yajC [Chromohalobacter salexigens DSM
           3043]
 gi|91798041|gb|ABE60180.1| protein translocase subunit yajC [Chromohalobacter salexigens DSM
           3043]
          Length = 109

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
               +AQ  +PA       +    +     +++YFLL RPQ ++ ++  +++ NL +GD 
Sbjct: 6   IPAAHAQDASPAGGG----IAQIVMLVGFVLIFYFLLWRPQAKRAKQHKQLIGNLAKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           IV   G++G++  V DD  + +EIAE   V V +S V+ V  K  
Sbjct: 62  IVIGGGLMGRITNVGDDF-ICMEIAEGTEVNVQKSSVAAVLPKGT 105


>gi|319787468|ref|YP_004146943.1| preprotein translocase subunit YajC [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465980|gb|ADV27712.1| preprotein translocase, YajC subunit [Pseudoxanthomonas suwonensis
           11-1]
          Length = 112

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
                 M     VL  + YFL+IRPQ ++ +    ML  L+RGD ++T +GI G V  + 
Sbjct: 20  QGGGFSMLLFPIVLIAIMYFLMIRPQMKRQKEHQAMLGKLQRGDEVLTNSGIAGVVTEIG 79

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +   + VEIA+NVR+RV ++ +  V  K  
Sbjct: 80  E-NFVTVEIADNVRIRVQKAAIGNVLPKGT 108


>gi|307946883|ref|ZP_07662218.1| preprotein translocase, YajC subunit [Roseibium sp. TrichSKD4]
 gi|307770547|gb|EFO29773.1| preprotein translocase, YajC subunit [Roseibium sp. TrichSKD4]
          Length = 111

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/90 (51%), Positives = 65/90 (72%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L     F  +  + YFL+IRPQRQ++++  +M+ NLRRGD+IVT  G++GKV +V+D
Sbjct: 17  PDFLISMLPFVAIFAIMYFLIIRPQRQRMKQHQDMVANLRRGDTIVTTGGLIGKVSKVVD 76

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E++VE+ E V+VRVVR  V EV+SKSEP
Sbjct: 77  DGEVQVELGEGVKVRVVRQMVQEVRSKSEP 106


>gi|262277201|ref|ZP_06054994.1| preprotein translocase, YajC subunit [alpha proteobacterium
           HIMB114]
 gi|262224304|gb|EEY74763.1| preprotein translocase, YajC subunit [alpha proteobacterium
           HIMB114]
          Length = 94

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 66/90 (73%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++ V++YFLLIRPQ+++++    M+  L RGD++VT+ GIVGK++RVID
Sbjct: 3   GKTLGQFIPLILIFVIFYFLLIRPQQKRIKEHKAMVEALTRGDNVVTSGGIVGKIIRVID 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           + + E+EIA+NV V+V++S +++V SK+EP
Sbjct: 63  NEKAEIEIADNVNVQVIKSTITQVLSKTEP 92


>gi|149908738|ref|ZP_01897399.1| preprotein translocase subunit YajC [Moritella sp. PE36]
 gi|149808280|gb|EDM68219.1| preprotein translocase subunit YajC [Moritella sp. PE36]
          Length = 112

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           F    A +       A    EM  +  +  V++YF++ RPQ ++ + +  ++ +L +G+ 
Sbjct: 3   FFIANAVAAEGVTGPAGGGYEMLIMLGIFGVIFYFMIYRPQAKRQKEQKNLMSSLSKGEE 62

Query: 62  IVTAAGIVGKVVRVID-DLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T  GIVGK+ ++ D +  + + IA+   V + R +++ V  K 
Sbjct: 63  VLTVGGIVGKITKISDGNDYVVISIADATNVTIKRDYIAAVLPKG 107


>gi|88799559|ref|ZP_01115135.1| preprotein translocase subunit YajC [Reinekea sp. MED297]
 gi|88777644|gb|EAR08843.1| preprotein translocase subunit YajC [Reinekea sp. MED297]
          Length = 173

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           SP ++  +  +  V+++ ++ RPQ ++ +    +L  L  GD +VT AGI GKV +V DD
Sbjct: 83  SPWQLPIMLGIFFVIFWLMVWRPQSKRAKEHKNLLSALSNGDEVVTNAGIAGKVKKVTDD 142

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             ++V++ +NV +   +  ++    K  
Sbjct: 143 -YVQVQVDDNVTLTFQKQAIAATLPKGT 169


>gi|149913918|ref|ZP_01902450.1| aconitate hydratase [Roseobacter sp. AzwK-3b]
 gi|149812202|gb|EDM72033.1| aconitate hydratase [Roseobacter sp. AzwK-3b]
          Length = 93

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 60/87 (68%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       ++  + Y LLIRPQ+++L+    M+  LRRGD +VT  G++GKV +V D  E
Sbjct: 4   IGQFIPLILIFAIMYLLLIRPQQKKLKEHRAMVDALRRGDQVVTQGGLIGKVAKVKDGDE 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +E+++++ VRVRVV+S +++V SK+EP
Sbjct: 64  IELDLSDTVRVRVVKSTIAQVLSKTEP 90


>gi|260433303|ref|ZP_05787274.1| preprotein translocase, YajC subunit [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417131|gb|EEX10390.1| preprotein translocase, YajC subunit [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 95

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 61/91 (67%), Gaps = 1/91 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + YFLLIRPQ+++++     +  +RRGD +VT  G++GKV +V +
Sbjct: 3   GGAIAQFLPLILIFAIMYFLLIRPQQKKMKEHQVFVEAVRRGDQVVTHGGLIGKVSKVKE 62

Query: 78  -DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            + E+EVEIA+ V+VRV++S +++V +K+EP
Sbjct: 63  GENEIEVEIADGVKVRVIKSTIAQVLNKTEP 93


>gi|110679779|ref|YP_682786.1| preprotein translocase, YajC subunit, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455895|gb|ABG32100.1| preprotein translocase, YajC subunit, putative [Roseobacter
           denitrificans OCh 114]
          Length = 92

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/87 (45%), Positives = 61/87 (70%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   ++  + YFLLIRPQ+++++    M+  LRRGD +VT  GI+GKVV+V DD E
Sbjct: 4   FAQFVPLILIFAIMYFLLIRPQQKKVKEHQAMVAALRRGDQVVTQGGILGKVVKVKDDGE 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           LE+EIA+ V+VRV+++ ++ V SK+EP
Sbjct: 64  LELEIADGVKVRVIQNTIATVVSKTEP 90


>gi|225677376|ref|ZP_03788346.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590584|gb|EEH11841.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + + V+A       +S  +         ++ VV+YFL+IRPQ+++L+   +M+  ++RGD
Sbjct: 2   LISEVFAADATSNTSSIGASFASFTPLILIFVVFYFLIIRPQQKKLREHRKMIDQIKRGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
           +++T+ GI+G+V +V +      +EIA  V ++V++S +SEV SK  
Sbjct: 62  TVITSGGIIGEVNKVDEANAQFIIEIAPKVEIKVLKSAISEVLSKET 108


>gi|50120060|ref|YP_049227.1| preprotein translocase subunit YajC [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610586|emb|CAG74031.1| putative membrane subunit of preprotein translocase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 110

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A + A A     SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGASA---QGSPYSLVIMLAVFGLIFYFMILRPQQKRGKEHKKLMDSIGKGDE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G+VG+V +V D   + + + E   V + R FV+ V  K  
Sbjct: 62  VLTTGGLVGRVTKVSDTGYIAIALNETNEVVIKRDFVAAVLPKGT 106


>gi|73542494|ref|YP_297014.1| preprotein translocase subunit YajC [Ralstonia eutropha JMP134]
 gi|72119907|gb|AAZ62170.1| protein translocase subunit yajC [Ralstonia eutropha JMP134]
          Length = 108

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +AQ+    +  A   L       ++  V +F++IRPQ ++ +    M+  L + D
Sbjct: 2   LISNAFAQTA--GVGGAAGGLMSFLPIILMFGVLWFIMIRPQMKRQKEAKAMMEALAKND 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +VTA GI+GKV +V  D  + +EIA    + V ++ V+ V  K 
Sbjct: 60  EVVTAGGILGKVTKVT-DQYVSLEIAPGTEITVQKNAVTTVLPKG 103


>gi|304407537|ref|ZP_07389189.1| preprotein translocase, YajC subunit [Paenibacillus curdlanolyticus
           YK9]
 gi|304343488|gb|EFM09330.1| preprotein translocase, YajC subunit [Paenibacillus curdlanolyticus
           YK9]
          Length = 113

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            A A +S      +   F ++  V+YFLLIRPQ+++ + R  ML  L++GD I T  G+ 
Sbjct: 4   AAEAASSGGGIWGLVLPFVLMFAVFYFLLIRPQQRKTKTRNLMLNQLKKGDKISTIGGMH 63

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           G +V + DD+ + V + + V++   RS ++ V S +
Sbjct: 64  GTIVELTDDVAV-VRVNDTVKITFERSAINNVISSA 98


>gi|261252140|ref|ZP_05944713.1| preprotein translocase subunit YajC [Vibrio orientalis CIP 102891]
 gi|260935531|gb|EEX91520.1| preprotein translocase subunit YajC [Vibrio orientalis CIP 102891]
          Length = 109

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A  +           EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 3   ISQAHAAVEGAPAGGG---FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKNLMGSMGKGDE 59

Query: 62  IVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T+ G+VGK+ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 60  VLTSGGLVGKITKIAEDNDYISIELNTNNEVVIKKDFVTAVLPKGT 105


>gi|320540311|ref|ZP_08039963.1| SecYEG protein translocase auxillary subunit [Serratia symbiotica
           str. Tucson]
 gi|320029631|gb|EFW11658.1| SecYEG protein translocase auxillary subunit [Serratia symbiotica
           str. Tucson]
          Length = 110

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 55/96 (57%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           +P   +  SP  +  +  +  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G
Sbjct: 11  SPGAPAQGSPYSLIIMLVMFGLIFYFMILRPQQKRAKDHKKLMDSIGKGDEVMTTGGLIG 70

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +V +V D   + + + +   V + R FV+ V  K  
Sbjct: 71  RVAKVADTGIITISLNDTTEVMIKRDFVAAVLPKGT 106


>gi|296115026|ref|ZP_06833668.1| preprotein translocase, YajC subunit [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978363|gb|EFG85099.1| preprotein translocase, YajC subunit [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 126

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           T  YAQS      SA   L     +  +  ++YFLLIRPQ+ + ++    L  LRRGD +
Sbjct: 11  TPAYAQSAGGGGFSAEG-LMSILPYVAMFGIFYFLLIRPQQVKQKQLRSQLSALRRGDRV 69

Query: 63  VTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQS 103
           +TA GI+  V +V +   E+EVE+A NVRV V+R  +S V +
Sbjct: 70  LTAGGIIAVVQKVSEGSNEVEVELAPNVRVTVLRDTISTVIT 111


>gi|160872056|ref|ZP_02062188.1| preprotein translocase, YajC subunit [Rickettsiella grylli]
 gi|159120855|gb|EDP46193.1| preprotein translocase, YajC subunit [Rickettsiella grylli]
          Length = 112

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 2/106 (1%)

Query: 2   FTTVYAQSDAPAI-TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
            T  +AQS   +  T  +S L    +     V++Y LL RPQ ++ +   +++ NL  GD
Sbjct: 5   ITDGFAQSTTTSAITPQSSGLSQILILLGFVVIFYLLLWRPQAKRAKEHRQLMANLAIGD 64

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + T  GIVGKV+R+  D  + ++IAENV + + ++ VS V  K  
Sbjct: 65  EVTTTGGIVGKVIRLNGD-LITLKIAENVEINLQKAAVSSVLPKGT 109


>gi|258404972|ref|YP_003197714.1| preprotein translocase, YajC subunit [Desulfohalobium retbaense DSM
           5692]
 gi|257797199|gb|ACV68136.1| preprotein translocase, YajC subunit [Desulfohalobium retbaense DSM
           5692]
          Length = 143

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 59/86 (68%), Gaps = 1/86 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           +P+       +L V++YFLLIRPQ+++ +   EML NL++GD ++T  G+ G++V   ++
Sbjct: 23  NPIMAFMPLIILFVIFYFLLIRPQQKKAKEHKEMLANLKKGDRVITGGGLYGRIVAASEE 82

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSK 104
             L VE+A+NV+++V R+++S +  K
Sbjct: 83  -MLTVEVADNVQLKVNRNYISTLVDK 107


>gi|84387608|ref|ZP_00990625.1| preprotein translocase subunit YajC [Vibrio splendidus 12B01]
 gi|84377453|gb|EAP94319.1| preprotein translocase subunit YajC [Vibrio splendidus 12B01]
          Length = 109

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A  +           EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 3   ISQAHAAVEGAPAGGG---FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKSLMSSMGKGDE 59

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T+ G++GK+ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 60  VLTSGGLIGKITKIAEDSDYVAIELNANNEVVIKKDFVTAVLPKGT 105


>gi|304321622|ref|YP_003855265.1| preprotein translocase, YajC subunit [Parvularcula bermudensis
           HTCC2503]
 gi|303300524|gb|ADM10123.1| preprotein translocase, YajC subunit [Parvularcula bermudensis
           HTCC2503]
          Length = 111

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/90 (45%), Positives = 62/90 (68%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            SPL     F V+ V++YFLLIRPQ+Q  ++  EM+  +RRGD +VTA G+VGKV +V  
Sbjct: 17  PSPLLQLIPFVVILVIFYFLLIRPQQQARKKHEEMVNAVRRGDEVVTAGGLVGKVTKVPG 76

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
             E+ V++ + V V VV++ +S V+S++EP
Sbjct: 77  GDEITVQVGDGVEVTVVKATLSAVRSRTEP 106


>gi|77462341|ref|YP_351845.1| protein translocase subunit yajC [Rhodobacter sphaeroides 2.4.1]
 gi|126461217|ref|YP_001042331.1| preprotein translocase, YajC subunit [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638199|ref|YP_002524461.1| protein translocase subunit yajC [Rhodobacter sphaeroides KD131]
 gi|332560224|ref|ZP_08414546.1| preprotein translocase, YajC subunit [Rhodobacter sphaeroides WS8N]
 gi|77386759|gb|ABA77944.1| protein translocase subunit yajC [Rhodobacter sphaeroides 2.4.1]
 gi|126102881|gb|ABN75559.1| protein translocase subunit yajC [Rhodobacter sphaeroides ATCC
           17029]
 gi|221158980|gb|ACL99959.1| Protein translocase subunit yajC [Rhodobacter sphaeroides KD131]
 gi|332277936|gb|EGJ23251.1| preprotein translocase, YajC subunit [Rhodobacter sphaeroides WS8N]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/87 (45%), Positives = 61/87 (70%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   ++ V+ YFLLIRPQ+++L+    M+  LRRGD ++T  GIVGKVV+V +D  
Sbjct: 19  FTSFVPLILIFVIMYFLLIRPQQKKLKEHKAMVEALRRGDQVLTGGGIVGKVVKVHEDGI 78

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           ++VEIA+ V+VRV++S + +V SK+EP
Sbjct: 79  VDVEIADGVKVRVMKSTIVQVMSKTEP 105


>gi|58582106|ref|YP_201122.1| preprotein translocase subunit YajC [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624008|ref|YP_451380.1| preprotein translocase subunit YajC [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188576287|ref|YP_001913216.1| preprotein translocase subunit YajC [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58426700|gb|AAW75737.1| preprotein translocase YajC subunit [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84367948|dbj|BAE69106.1| preprotein translocase YajC subunit [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188520739|gb|ACD58684.1| preprotein translocase, YajC subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 117

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                L    L  +L  V YFL+IRPQ ++ +    +L  L RGD ++T+ G+ G +  +
Sbjct: 23  GPLGGLSTFALPVILIAVMYFLMIRPQMKRQKEHKALLDKLARGDEVITSGGVAGVITEI 82

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D  + VE+A+NVR+RV +S V  V  K  
Sbjct: 83  -GDNFISVEVADNVRIRVQKSAVGHVLPKGT 112


>gi|90407018|ref|ZP_01215208.1| preprotein translocase subunit YajC [Psychromonas sp. CNPT3]
 gi|90311889|gb|EAS39984.1| preprotein translocase subunit YajC [Psychromonas sp. CNPT3]
          Length = 111

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A ++ PA     S      +  + A ++YF++ RPQ ++ ++   ++ +L +GD 
Sbjct: 5   ISQAQAATEGPATQ---SSFSFIFMMVIFAAIFYFMIYRPQAKRTKQHKSLMESLSKGDE 61

Query: 62  IVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+V +V  +   L++E+ EN  + + R F+S V  K  
Sbjct: 62  VLTQGGLIGRVTKVNVESGYLQLELNENNVISIKRDFISAVLPKGT 107


>gi|240850250|ref|YP_002971643.1| preprotein translocase YajC subunit [Bartonella grahamii as4aup]
 gi|240267373|gb|ACS50961.1| preprotein translocase YajC subunit [Bartonella grahamii as4aup]
          Length = 150

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ       S            ++  + YF +IRPQR Q+++R EML  +RRGD+
Sbjct: 3   ITNAYAQVAG--DVSGGISFASVVPLILIFAIMYFFIIRPQRAQMKKRQEMLNAVRRGDT 60

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           ++T  GI+GKV +V D+  ELEVEI E++ +RV+RS +++V+ K EP+
Sbjct: 61  VITGGGIIGKVTKVHDESGELEVEIGESMNIRVIRSTLADVRVKGEPI 108


>gi|288574628|ref|ZP_06392985.1| preprotein translocase, YajC subunit [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570369|gb|EFC91926.1| preprotein translocase, YajC subunit [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 125

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 55/94 (58%), Gaps = 1/94 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
            T     ++M     +  V++YF +IRPQ+++ ++  E+L +L RGD +VTA G +G V 
Sbjct: 3   QTGQAGAMQMFFPLVIFVVIFYFFIIRPQKKRQKKHDELLGSLTRGDRVVTAGGFIGIVR 62

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            V DD  L +EIA+ V+VRV++  VS       P
Sbjct: 63  EVKDDS-LILEIADGVKVRVLKGSVSSKMVTETP 95


>gi|300114440|ref|YP_003761015.1| preprotein translocase subunit YajC [Nitrosococcus watsonii C-113]
 gi|299540377|gb|ADJ28694.1| preprotein translocase, YajC subunit [Nitrosococcus watsonii C-113]
          Length = 111

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
               +AQS  P             +F  + +V+Y L IRP+ ++ + R  ML ++ +GD 
Sbjct: 5   IADAWAQSSPPPGAPG-DFWVPLLIFSTIFLVYYLLAIRPRLKRHKERLRMLASVNKGDE 63

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           I+T  G++G+V++V  D  L +E++E + V+V +S VS V  K  
Sbjct: 64  IITNGGLLGRVLQV-GDNFLLLELSEGMEVKVEKSAVSRVVPKGT 107


>gi|83719987|ref|YP_441824.1| preprotein translocase subunit YajC [Burkholderia thailandensis
           E264]
 gi|167580650|ref|ZP_02373524.1| preprotein translocase subunit YajC [Burkholderia thailandensis
           TXDOH]
 gi|167618754|ref|ZP_02387385.1| preprotein translocase subunit YajC [Burkholderia thailandensis
           Bt4]
 gi|257137992|ref|ZP_05586254.1| preprotein translocase subunit YajC [Burkholderia thailandensis
           E264]
 gi|83653812|gb|ABC37875.1| preprotein translocase, YajC subunit [Burkholderia thailandensis
           E264]
          Length = 108

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++  V YF++IRPQ ++ +    ML  + +GD +VT+ G+VGKV +V + 
Sbjct: 18  SSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGDEVVTSGGLVGKVTKVSEA 77

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             + VEIAE   + V +S V+ +  K  
Sbjct: 78  -YIGVEIAEGTEITVQKSAVTTILPKGT 104


>gi|254449208|ref|ZP_05062657.1| preprotein translocase, YajC subunit [gamma proteobacterium
           HTCC5015]
 gi|198261185|gb|EDY85481.1| preprotein translocase, YajC subunit [gamma proteobacterium
           HTCC5015]
          Length = 124

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L       VL VV YFL+IRPQ+++ +   +M+  L++GD +VT+ GI+GKV  V  D  
Sbjct: 28  LLQLLPIVVLFVVMYFLMIRPQQKRAKEHRQMVEALKKGDEVVTSGGILGKVTEV-GDAF 86

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           +E+++ +N  +R+ R  +  V  K  
Sbjct: 87  IELKVNDNSSLRLQRQAIQSVMPKGT 112


>gi|304391788|ref|ZP_07373730.1| immunogenic membrane protein YajC [Ahrensia sp. R2A130]
 gi|303296017|gb|EFL90375.1| immunogenic membrane protein YajC [Ahrensia sp. R2A130]
          Length = 130

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQ+      +    +E+     ++  + +FL+IRPQRQ  ++R  ML  ++R D+
Sbjct: 3   ITPAYAQTA---GGAGGGVIELLFPLILVGGIMWFLVIRPQRQAQKKRDAMLAAVKRNDT 59

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           I+T  G+VGKV +VIDD ELE EIA  V+VR++RS +++V+ K EPV
Sbjct: 60  IITGGGVVGKVTKVIDDAELEAEIASGVKVRLMRSMIADVRVKGEPV 106


>gi|241204423|ref|YP_002975519.1| preprotein translocase subunit YajC [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858313|gb|ACS55980.1| preprotein translocase, YajC subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 115

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 59/108 (54%), Positives = 75/108 (69%), Gaps = 1/108 (0%)

Query: 2   FTTVYAQSDAPAITS-ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
            T  +AQS     T    S  EM  LF  L VVWYFLLIRPQR Q ++R E L+ +RRGD
Sbjct: 3   ITPAFAQSATDTATGFGGSGFEMIILFVPLMVVWYFLLIRPQRAQAKKREETLKAIRRGD 62

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +VT  G+VGKV +V+D+ E+EVEIA+ VRVR+VRS +SE++ K EPV
Sbjct: 63  QVVTGGGLVGKVTKVVDEKEVEVEIADGVRVRIVRSGISEIRVKGEPV 110


>gi|42526197|ref|NP_971295.1| preprotein translocase, YajC subunit [Treponema denticola ATCC
           35405]
 gi|41816309|gb|AAS11176.1| preprotein translocase, YajC subunit [Treponema denticola ATCC
           35405]
          Length = 137

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 2/97 (2%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
                             ++ V++YFLLIRPQ+++ Q+  +M+  L++GD I+T  GI G
Sbjct: 8   QGTAPGGFGSFGFLIPMLLVFVIFYFLLIRPQKKEQQKTEKMISQLQKGDKIITIGGIHG 67

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            VV    +  + +++ +N ++ + RS V  V  K EP
Sbjct: 68  -VVSSTKEKTIIIKVDDNCKIEINRSAVGAVL-KDEP 102


>gi|182415276|ref|YP_001820342.1| preprotein translocase, YajC subunit [Opitutus terrae PB90-1]
 gi|177842490|gb|ACB76742.1| preprotein translocase, YajC subunit [Opitutus terrae PB90-1]
          Length = 114

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A       SP      F +L    YFL+I PQR++ +   +ML+ L  GD IVT+ GI G
Sbjct: 15  AQQAAPGGSPWTQFIFFGLLFAAMYFLMIAPQRKKQKEHEKMLKALTSGDEIVTSGGIYG 74

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
            +  V DD  + V IA+N ++ V ++FV+ V  K
Sbjct: 75  TITNVKDDRFV-VRIADNTKIEVGKAFVTAVVKK 107


>gi|84502990|ref|ZP_01001092.1| preprotein translocase, YajC subunit [Oceanicola batsensis
           HTCC2597]
 gi|84388735|gb|EAQ01606.1| preprotein translocase, YajC subunit [Oceanicola batsensis
           HTCC2597]
          Length = 96

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/90 (45%), Positives = 65/90 (72%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + YFLLIRPQ+++L+   +M+  +RRGD +VT  GI+GKVV+V D
Sbjct: 3   GGAIAQFLPLILIFAIMYFLLIRPQQKKLKDHQKMVEAVRRGDLVVTQGGIIGKVVKVRD 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVEIAE V+VRV+++ +++V+SK+EP
Sbjct: 63  DGEIEVEIAEGVKVRVIKATLADVKSKTEP 92


>gi|114563866|ref|YP_751380.1| preprotein translocase subunit YajC [Shewanella frigidimarina NCIMB
           400]
 gi|114335159|gb|ABI72541.1| protein translocase subunit yajC [Shewanella frigidimarina NCIMB
           400]
          Length = 110

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA     +  +    +++  +  +  +++YF++ RPQ ++++    ++ ++ +GD 
Sbjct: 3   ISNAYA--SPISGVAGGETMQLIFMLVMFGLIFYFMIFRPQSKRVKEHKNLMASISKGDE 60

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T+ GI+GKV ++ ++   + + I +N ++ + + +++ V  K 
Sbjct: 61  VLTSGGILGKVTKIGEESDYVLLAINDNNQITIKKDYIAAVLPKG 105


>gi|120554043|ref|YP_958394.1| preprotein translocase, YajC subunit [Marinobacter aquaeolei VT8]
 gi|120323892|gb|ABM18207.1| protein translocase subunit yajC [Marinobacter aquaeolei VT8]
          Length = 120

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 4/106 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M     AQ    A     S +     F    +++YFL+ RPQ ++ +    ++  L +GD
Sbjct: 15  MPALASAQE---AGAQGMSVMGQIIFFAGFILIFYFLIWRPQSKRAKEHKALMSGLNKGD 71

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT+ G+ GK+ +V DD  + +E+A+NV ++V +  V+    K  
Sbjct: 72  EVVTSGGVAGKITKVTDDF-IVLEVADNVEMKVQKVAVAAALPKGT 116


>gi|251790676|ref|YP_003005397.1| preprotein translocase subunit YajC [Dickeya zeae Ech1591]
 gi|271499569|ref|YP_003332594.1| preprotein translocase subunit YajC [Dickeya dadantii Ech586]
 gi|307129894|ref|YP_003881910.1| secYEG protein translocase auxillary subunit [Dickeya dadantii
           3937]
 gi|247539297|gb|ACT07918.1| preprotein translocase, YajC subunit [Dickeya zeae Ech1591]
 gi|270343124|gb|ACZ75889.1| preprotein translocase, YajC subunit [Dickeya dadantii Ech586]
 gi|306527423|gb|ADM97353.1| SecYEG protein translocase auxillary subunit [Dickeya dadantii
           3937]
          Length = 111

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 53/90 (58%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+VG+V +V 
Sbjct: 18  QGSPYSLVIMLAVFGLIFYFMILRPQQKRAKEHKKLMDSISKGDEVLTNGGLVGRVTKVA 77

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D+  + + + +   V + R +V+ V  K  
Sbjct: 78  DNGFITIALNDTNEVVIKRDYVTSVLPKGT 107


>gi|85058625|ref|YP_454327.1| preprotein translocase subunit YajC [Sodalis glossinidius str.
           'morsitans']
 gi|84779145|dbj|BAE73922.1| preprotein translocase YajC subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 110

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 56/97 (57%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            A    S +SP  +  +  V  +++YF+++RPQ+++ +   E++ ++ +GD ++T  G+V
Sbjct: 10  AATGAPSQSSPYSLVVMLVVFGLIFYFMILRPQQKRAKVHKELMSSISKGDEVLTTGGLV 69

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           G+VV+V D   + + + +   V + R FV+ V  K  
Sbjct: 70  GRVVKVADTGYISIALNDTNEVVIKRDFVAAVLPKGT 106


>gi|167586183|ref|ZP_02378571.1| preprotein translocase, YajC subunit [Burkholderia ubonensis Bu]
          Length = 108

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++  V YF++IRPQ ++ +    ML  + +GD +VT+ G+VGKV +V + 
Sbjct: 18  SSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLSAMAKGDEVVTSGGLVGKVTKVSEA 77

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             + VEIAE   + V ++ V+ +  K  
Sbjct: 78  -YIGVEIAEGTEITVQKAAVTTILPKGT 104


>gi|254785824|ref|YP_003073253.1| preprotein translocase, YajC subunit [Teredinibacter turnerae
           T7901]
 gi|237685068|gb|ACR12332.1| preprotein translocase, YajC subunit [Teredinibacter turnerae
           T7901]
          Length = 111

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 53/105 (50%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
                AQS   A +     +    +   L +  YF++IRPQR++ +    ++  L +GD 
Sbjct: 5   IADAMAQSTDAAGSPNGG-IMQIVMLVGLFLFMYFIIIRPQRKRQKEHQSLVDALSKGDE 63

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +V  +G++GK++ V D+  + + +A+NV ++  +  V  V  K  
Sbjct: 64  VVMTSGMLGKIIEV-DEGYVTLNVAQNVDLKFQKVAVHAVLPKGT 107


>gi|124265469|ref|YP_001019473.1| protein translocase subunit yajC [Methylibium petroleiphilum PM1]
 gi|124258244|gb|ABM93238.1| protein translocase subunit yajC [Methylibium petroleiphilum PM1]
          Length = 108

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S L       ++ VV YF++IRPQ ++ +    M+  L +GD +VTA G++GKV ++
Sbjct: 17  GGESSLLTMLPLVLMFVVLYFVMIRPQMKRQKEHKAMVDALAKGDEVVTAGGVLGKVAKI 76

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D  L VE+A  V ++V RS V +V  K  
Sbjct: 77  -GDTYLHVEVASGVELQVQRSAVVQVLPKGT 106


>gi|50083825|ref|YP_045335.1| IISP family preprotein translocase [Acinetobacter sp. ADP1]
 gi|49529801|emb|CAG67513.1| putative SecYEG protein translocase auxillary subunit (YajC)
           [Acinetobacter sp. ADP1]
          Length = 109

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +T +A   AP        +    +  V   ++YFL+ RPQ ++ +    ++ +L  G 
Sbjct: 4   LISTAHAADAAPQGPG---MMANILMIVVFVAIFYFLIWRPQSKRAKEHRTLVESLGVGS 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +V A G++G++ ++  D  + VE++  V V++ R+ V  V  +  
Sbjct: 61  EVVFAGGLMGRITKIEGDYAV-VELSRGVEVKIQRASVISVLPEGT 105


>gi|319406049|emb|CBI79679.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 152

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  YAQ  A + TS          F ++  + YFL+IRPQR Q+++R EML  +RRGD
Sbjct: 2   LVTNAYAQ--AISDTSNGISFITFVPFILIFAIMYFLIIRPQRAQMKKRQEMLNAVRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           ++VT  G++GKV +V D+  ELEVEI+E++R+RV+RS +++V+ K EP+
Sbjct: 60  TVVTGGGVLGKVTKVYDESGELEVEISEDIRIRVIRSTLADVRVKGEPL 108


>gi|163746864|ref|ZP_02154221.1| preprotein translocase, YajC subunit, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161379978|gb|EDQ04390.1| preprotein translocase, YajC subunit, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 92

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/90 (45%), Positives = 62/90 (68%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              ++      ++  + YFLLIRPQ+++ +    M+  LRRGD +VT  GI+GKVV+V +
Sbjct: 1   MEGIQQFVPLILIFAIMYFLLIRPQQKKAKEHQAMVAGLRRGDQVVTQGGIIGKVVKVKE 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D E+EVEIAE V+VRVV++ ++ V SK+EP
Sbjct: 61  DGEVEVEIAEGVKVRVVQATIATVVSKTEP 90


>gi|242240321|ref|YP_002988502.1| preprotein translocase, YajC subunit [Dickeya dadantii Ech703]
 gi|242132378|gb|ACS86680.1| preprotein translocase, YajC subunit [Dickeya dadantii Ech703]
          Length = 111

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 53/90 (58%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+VG+V +V 
Sbjct: 18  QGSPYSLVIMLAVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDEVLTNGGLVGRVTKVA 77

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D+  + + + +   V + R +V+ V  K  
Sbjct: 78  DNGFITIALNDTNEVVIKRDYVTSVLPKGT 107


>gi|146328728|ref|YP_001208977.1| preprotein translocase, YajC subunit [Dichelobacter nodosus
           VCS1703A]
 gi|146232198|gb|ABQ13176.1| preprotein translocase, YajC subunit [Dichelobacter nodosus
           VCS1703A]
          Length = 134

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 60/105 (57%), Gaps = 2/105 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  YAQS      ++ S +       ++  V ++L++RPQ+++ +    ML  L++GD
Sbjct: 3   LISQAYAQSAPAQANASGSGV-QFIFIAIMFAVIWYLILRPQQKRAKEHRNMLEALKKGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            ++T  G++G+V+   +D  +++EIA+ + VR+ + F+ +   K 
Sbjct: 62  EVMTNGGLMGRVIAF-NDQAIDIEIAKGIIVRLQKGFIVQTLPKG 105


>gi|237747212|ref|ZP_04577692.1| preprotein translocase subunit YajC [Oxalobacter formigenes HOxBLS]
 gi|229378563|gb|EEO28654.1| preprotein translocase subunit YajC [Oxalobacter formigenes HOxBLS]
          Length = 108

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  YAQS A     +   +       ++ V+ YFL+IRPQ+++ + + +ML  L  GD 
Sbjct: 3   ITNAYAQSAA--SGFSLDSIGSFLPILLMFVLLYFLMIRPQQKKQREQRDMLSALSAGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++TA GIVGK+ +V ++  + +EI+    + + ++ +  +     
Sbjct: 61  VLTAGGIVGKITKVSENF-ITLEISAGTEIIIQKASIVSLLPNGT 104


>gi|304413740|ref|ZP_07395184.1| preprotein translocase subunit YajC [Candidatus Regiella
           insecticola LSR1]
 gi|304283831|gb|EFL92225.1| preprotein translocase subunit YajC [Candidatus Regiella
           insecticola LSR1]
          Length = 120

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +     A +  PA     +P  M  +  V  +++YF+++RPQ+++ +   +++ ++ +GD
Sbjct: 14  LIPEAIASAGDPA---QGNPYSMIIMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGD 70

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T  G +G+V+++ +   + + + +   V + R FV+ V  K  
Sbjct: 71  EVLTTGGFLGRVIKIAETGYIVIALNDTTEVMIKRDFVAAVLPKGT 116


>gi|88812649|ref|ZP_01127896.1| preprotein translocase subunit YajC [Nitrococcus mobilis Nb-231]
 gi|88790065|gb|EAR21185.1| preprotein translocase subunit YajC [Nitrococcus mobilis Nb-231]
          Length = 130

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 56/106 (52%), Gaps = 5/106 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +   AQS   A                L  ++YFLLIRPQ+++ +   +++ NL +GD
Sbjct: 4   LISDAMAQSGPAAGPGLGGL----IFPIALIAIFYFLLIRPQQKRAKEHKKLVANLGKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T  G++G++  V +     +EIA+ V VR+ +S V++V  K  
Sbjct: 60  EVITNGGLMGQITDVGEG-YAALEIADGVEVRIQKSAVAQVLPKGT 104


>gi|291613428|ref|YP_003523585.1| preprotein translocase, YajC subunit [Sideroxydans lithotrophicus
           ES-1]
 gi|291583540|gb|ADE11198.1| preprotein translocase, YajC subunit [Sideroxydans lithotrophicus
           ES-1]
          Length = 114

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 58/105 (55%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA   APA   +   +        L  V+YFL++RPQ+++ + +  M+  L++GD 
Sbjct: 10  ISNAYADGGAPAPQGS---IMEFLPLIALVAVFYFLILRPQQKRAKEQKAMIEALQKGDE 66

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           + T  G++GKV +V +D    +EIA+NV ++V ++ +  V  K  
Sbjct: 67  VATVGGVLGKVTKVGEDSAA-IEIADNVVIQVQKAAIQNVLPKGT 110


>gi|78222073|ref|YP_383820.1| protein translocase subunit yajC [Geobacter metallireducens GS-15]
 gi|78193328|gb|ABB31095.1| protein translocase subunit yajC [Geobacter metallireducens GS-15]
          Length = 106

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 56/104 (53%), Gaps = 4/104 (3%)

Query: 1   MFTTVYAQSDAPAI---TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           MF   +A +  P       A    +       +  ++YFLLIRPQ+++ +    +L +L+
Sbjct: 1   MFGVAFAMAAQPGGAQPGGAMGAFQAILPLVFMFAIFYFLLIRPQQKKAKDHRTLLDSLK 60

Query: 58  RGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           +GD +VTA GI GKV   ID   + +EIA  V +++ + +++ +
Sbjct: 61  KGDQVVTAGGIHGKV-GAIDGDVVLLEIASGVTIKISKGYIATL 103


>gi|153822718|ref|ZP_01975385.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|229510684|ref|ZP_04400163.1| preprotein translocase subunit YajC [Vibrio cholerae B33]
 gi|229608662|ref|YP_002879310.1| preprotein translocase subunit YajC [Vibrio cholerae MJ-1236]
 gi|254847879|ref|ZP_05237229.1| preprotein translocase subunit YajC [Vibrio cholerae MO10]
 gi|255744549|ref|ZP_05418500.1| preprotein translocase subunit YajC [Vibrio cholera CIRS 101]
 gi|126519749|gb|EAZ76972.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|229350649|gb|EEO15590.1| preprotein translocase subunit YajC [Vibrio cholerae B33]
 gi|229371317|gb|ACQ61740.1| preprotein translocase subunit YajC [Vibrio cholerae MJ-1236]
 gi|254843584|gb|EET21998.1| preprotein translocase subunit YajC [Vibrio cholerae MO10]
 gi|255737580|gb|EET92974.1| preprotein translocase subunit YajC [Vibrio cholera CIRS 101]
          Length = 110

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 57/107 (53%), Gaps = 4/107 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +A   A          EM  +  + AV++YF++ RPQ ++++    ++  + +GD
Sbjct: 3   LISVAHA---AGEGAPQGVGFEMIIMLAMFAVIFYFMIYRPQAKRVKEHKNLMAAMAKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+VG++ ++ +D   + +E+  N  V + + FV+ V  K  
Sbjct: 60  EVLTSGGLVGRITKIAEDNAYITIELNTNNEVVIKKDFVTAVLPKGT 106


>gi|126736002|ref|ZP_01751746.1| preprotein translocase, YajC subunit [Roseobacter sp. CCS2]
 gi|126714559|gb|EBA11426.1| preprotein translocase, YajC subunit [Roseobacter sp. CCS2]
          Length = 117

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 42/86 (48%), Positives = 65/86 (75%), Gaps = 2/86 (2%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD--LEL 81
             +  ++  + YFLLIRPQ+++L++ A ML  LRRGD I+T  G+VGK+V+V +D   E+
Sbjct: 29  LIMLLLIFAIMYFLLIRPQQKKLKQHATMLEGLRRGDQIITQGGVVGKIVKVKEDDSNEV 88

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEP 107
           EVEIA++V+VRVV+S ++ V +K+EP
Sbjct: 89  EVEIAKDVKVRVVKSTIATVINKTEP 114


>gi|53720478|ref|YP_109464.1| preprotein translocase subunit YajC [Burkholderia pseudomallei
           K96243]
 gi|53726171|ref|YP_103941.1| preprotein translocase subunit YajC [Burkholderia mallei ATCC
           23344]
 gi|76808691|ref|YP_334743.1| preprotein translocase subunit YajC [Burkholderia pseudomallei
           1710b]
 gi|121600200|ref|YP_991653.1| preprotein translocase subunit YajC [Burkholderia mallei SAVP1]
 gi|124386223|ref|YP_001027149.1| preprotein translocase subunit YajC [Burkholderia mallei NCTC
           10229]
 gi|126439640|ref|YP_001060340.1| preprotein translocase subunit YajC [Burkholderia pseudomallei 668]
 gi|126449579|ref|YP_001082098.1| preprotein translocase subunit YajC [Burkholderia mallei NCTC
           10247]
 gi|126452530|ref|YP_001067600.1| preprotein translocase subunit YajC [Burkholderia pseudomallei
           1106a]
 gi|134280182|ref|ZP_01766893.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           305]
 gi|167000542|ref|ZP_02266354.1| preprotein translocase, YajC subunit [Burkholderia mallei PRL-20]
 gi|167721140|ref|ZP_02404376.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           DM98]
 gi|167740110|ref|ZP_02412884.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei 14]
 gi|167817321|ref|ZP_02449001.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei 91]
 gi|167825731|ref|ZP_02457202.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei 9]
 gi|167847218|ref|ZP_02472726.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           B7210]
 gi|167895805|ref|ZP_02483207.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           7894]
 gi|167904194|ref|ZP_02491399.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           NCTC 13177]
 gi|167912451|ref|ZP_02499542.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           112]
 gi|167920406|ref|ZP_02507497.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           BCC215]
 gi|217420697|ref|ZP_03452202.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           576]
 gi|226198367|ref|ZP_03793936.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237813728|ref|YP_002898179.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238562009|ref|ZP_00441103.2| preprotein translocase, YajC subunit [Burkholderia mallei GB8 horse
           4]
 gi|242317179|ref|ZP_04816195.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           1106b]
 gi|254178798|ref|ZP_04885452.1| preprotein translocase, YajC subunit [Burkholderia mallei ATCC
           10399]
 gi|254180719|ref|ZP_04887317.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           1655]
 gi|254191549|ref|ZP_04898052.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254194967|ref|ZP_04901397.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           S13]
 gi|254202655|ref|ZP_04909018.1| preprotein translocase, YajC subunit [Burkholderia mallei FMH]
 gi|254207996|ref|ZP_04914346.1| preprotein translocase, YajC subunit [Burkholderia mallei JHU]
 gi|254260392|ref|ZP_04951446.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           1710a]
 gi|254299195|ref|ZP_04966645.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           406e]
 gi|254355862|ref|ZP_04972140.1| preprotein translocase, YajC subunit [Burkholderia mallei
           2002721280]
 gi|52210892|emb|CAH36880.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|52429594|gb|AAU50187.1| preprotein translocase, YajC subunit [Burkholderia mallei ATCC
           23344]
 gi|76578144|gb|ABA47619.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           1710b]
 gi|121229010|gb|ABM51528.1| preprotein translocase, YajC subunit [Burkholderia mallei SAVP1]
 gi|124294243|gb|ABN03512.1| preprotein translocase, YajC subunit [Burkholderia mallei NCTC
           10229]
 gi|126219133|gb|ABN82639.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           668]
 gi|126226172|gb|ABN89712.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           1106a]
 gi|126242449|gb|ABO05542.1| preprotein translocase, YajC subunit [Burkholderia mallei NCTC
           10247]
 gi|134248189|gb|EBA48272.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           305]
 gi|147746902|gb|EDK53979.1| preprotein translocase, YajC subunit [Burkholderia mallei FMH]
 gi|147751890|gb|EDK58957.1| preprotein translocase, YajC subunit [Burkholderia mallei JHU]
 gi|148024837|gb|EDK83015.1| preprotein translocase, YajC subunit [Burkholderia mallei
           2002721280]
 gi|157808895|gb|EDO86065.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           406e]
 gi|157939220|gb|EDO94890.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160694712|gb|EDP84720.1| preprotein translocase, YajC subunit [Burkholderia mallei ATCC
           10399]
 gi|169651716|gb|EDS84409.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           S13]
 gi|184211258|gb|EDU08301.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           1655]
 gi|217396109|gb|EEC36126.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           576]
 gi|225929550|gb|EEH25568.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237505131|gb|ACQ97449.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238523483|gb|EEP86921.1| preprotein translocase, YajC subunit [Burkholderia mallei GB8 horse
           4]
 gi|242140418|gb|EES26820.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           1106b]
 gi|243063596|gb|EES45782.1| preprotein translocase, YajC subunit [Burkholderia mallei PRL-20]
 gi|254219081|gb|EET08465.1| preprotein translocase, YajC subunit [Burkholderia pseudomallei
           1710a]
          Length = 108

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++  V YF++IRPQ ++ +    ML  + +GD +VT+ G+VGKV +V + 
Sbjct: 18  SSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGDEVVTSGGLVGKVTKVSEA 77

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             + VEIAE   + V ++ V+ +  K  
Sbjct: 78  -YIGVEIAEGTEITVQKAAVTTILPKGT 104


>gi|260773397|ref|ZP_05882313.1| preprotein translocase subunit YajC [Vibrio metschnikovii CIP
           69.14]
 gi|260612536|gb|EEX37739.1| preprotein translocase subunit YajC [Vibrio metschnikovii CIP
           69.14]
          Length = 110

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 59/107 (55%), Gaps = 4/107 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +A   A    S     EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD
Sbjct: 3   LISVAHA---AGEGASQGGGFEMLIMLGMFAVIFYFMIYRPQSKRVKEHKSLMASMAKGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+  +VG++ ++ DD + + VE+  N  V + + FVS V  K  
Sbjct: 60  EVLTSGVLVGRITKIADDNDFISVELNNNNEVVIKKDFVSAVLPKGT 106


>gi|254293770|ref|YP_003059793.1| preprotein translocase, YajC subunit [Hirschia baltica ATCC 49814]
 gi|254042301|gb|ACT59096.1| preprotein translocase, YajC subunit [Hirschia baltica ATCC 49814]
          Length = 117

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/104 (32%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 4   TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
            ++  + A       SPL     F  + V+ YF +IRPQ+++ +    M+  + +GD+IV
Sbjct: 6   LIFQVTSADGAAGQPSPLLQMLPFAGILVILYFTMIRPQQKRQKEHQAMVNAVVKGDTIV 65

Query: 64  TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           T  G++GK+ RV +D E+ ++  E V++RV+R+ + EV+ K+ P
Sbjct: 66  TTGGLIGKITRV-EDTEVVIDAGEGVKLRVLRAMIVEVRGKNTP 108


>gi|254512179|ref|ZP_05124246.1| preprotein translocase, YajC subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221535890|gb|EEE38878.1| preprotein translocase, YajC subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 95

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/91 (40%), Positives = 63/91 (69%), Gaps = 1/91 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  + YFLLIRPQ++++++   M+  +RRGD +VT  G++GKV +V +
Sbjct: 3   GGAIAQFLPLILIFGIMYFLLIRPQQKKVKQHQAMVEAVRRGDQVVTQGGLIGKVSKVKE 62

Query: 78  -DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            + E+EVE+AE V+VRVV+S +++V SK+EP
Sbjct: 63  GENEIEVELAEGVKVRVVKSTIAQVLSKTEP 93


>gi|56476204|ref|YP_157793.1| preprotein translocase subunit YajC [Aromatoleum aromaticum EbN1]
 gi|56312247|emb|CAI06892.1| Sec-system component preprotein translocase subunit YajC
           [Aromatoleum aromaticum EbN1]
          Length = 108

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YAQ  APA       + M     ++ +V +FL+IRPQ ++ +    M+  + +GD 
Sbjct: 3   ISNAYAQ-AAPAGDPTGGLMGML-PLILMFIVLWFLMIRPQMKRAKEHKAMVAAIAKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           IVT  GI G+V +V ++  L VE+A+NV V V    V+ V  K  
Sbjct: 61  IVTQGGIAGRVTQVGENF-LHVEVADNVNVVVQAQSVTNVLPKGT 104


>gi|251798371|ref|YP_003013102.1| preprotein translocase, YajC subunit [Paenibacillus sp. JDR-2]
 gi|247545997|gb|ACT03016.1| preprotein translocase, YajC subunit [Paenibacillus sp. JDR-2]
          Length = 104

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A      T+  +M   F ++  V+YFLLIRPQ+++ ++R  +L  L++GD I T  G+ G
Sbjct: 6   AAGEAGGTNIFQMIWPFILMFAVFYFLLIRPQQKKTKQRNSLLSQLKKGDKIQTIGGLQG 65

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +V + DD  + + + +  ++   RS +S V + +
Sbjct: 66  TIVELTDD-IVVLRVNDTTKMTFDRSAISSVLNSA 99


>gi|167837804|ref|ZP_02464687.1| preprotein translocase, YajC subunit [Burkholderia thailandensis
           MSMB43]
          Length = 108

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++  V YF++IRPQ ++ +    ML  + +GD +VT+ G+VGKV +V + 
Sbjct: 18  SSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRNMLAAMAKGDEVVTSGGLVGKVTKVSEA 77

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             + VEIAE   + V ++ V+ +  K  
Sbjct: 78  -YIGVEIAEGTEITVQKAAVTTILPKGT 104


>gi|154248228|ref|YP_001419186.1| preprotein translocase, YajC subunit [Xanthobacter autotrophicus
           Py2]
 gi|154162313|gb|ABS69529.1| preprotein translocase, YajC subunit [Xanthobacter autotrophicus
           Py2]
          Length = 115

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 69/107 (64%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF T      A         L     F ++ VV YFL++RPQ+++ +   EM+  LRRGD
Sbjct: 1   MFITPAFAQGATGAGGGADMLIQLAPFLLIFVVMYFLILRPQQKRAKAHQEMVGALRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            IVTA G+VGKV RV+DD E+E++IA+NVRVR +R+ ++ V++K EP
Sbjct: 61  VIVTAGGLVGKVTRVVDDAEIELQIADNVRVRQLRTQIATVRAKGEP 107


>gi|304311794|ref|YP_003811392.1| Sec-system component preprotein translocase subunit [gamma
           proteobacterium HdN1]
 gi|301797527|emb|CBL45747.1| Sec-system component preprotein translocase subunit [gamma
           proteobacterium HdN1]
          Length = 110

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           F    A ++   +    S L           ++YFLL RPQ ++ + + E+L NL +GD 
Sbjct: 3   FFIADAWAEGAPVAGEPSLLMNLLPLLAFVAIFYFLLWRPQSKRNKEQKELLGNLNKGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++ A G++GK+ +V+DD  + VE+A N+ +R  +S VS    K  
Sbjct: 63  VLLAGGMLGKITKVVDD-YIVVEVANNIEIRFQKSAVSASLPKGT 106


>gi|322382938|ref|ZP_08056770.1| preprotein translocase subunit YajC-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321153058|gb|EFX45516.1| preprotein translocase subunit YajC-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 103

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 8   QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAG 67
           Q  A         L   G   ++ VV YFLLIRPQ+++ + R  ML NL++GD +VT  G
Sbjct: 2   QLAAAQQAGGMGFLFTYGPLILMFVVLYFLLIRPQQKRQKARNLMLSNLKKGDKVVTIGG 61

Query: 68  IVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           + G +V + DD  + + + +  ++   R  V+ V + +
Sbjct: 62  LHGSIVEITDD-VVVLRVNDTTKLTFDRGSVNTVVNST 98


>gi|114327911|ref|YP_745068.1| protein translocase subunit YajC [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316085|gb|ABI62145.1| protein translocase subunit YajC [Granulibacter bethesdensis
           CGDNIH1]
          Length = 119

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 64/104 (61%), Gaps = 4/104 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T  +AQS   A    T+ +       ++  V+YFLLIRPQ+QQ ++    L  L+RGD
Sbjct: 5   LITPAFAQS---AGGVGTTEMMQYLPLLLVFGVFYFLLIRPQQQQAKKLKATLAGLKRGD 61

Query: 61  SIVTAAGIVGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQS 103
            +VT+ GIVG+VV+  D   E+EVEIA NV+V V+R  ++ V +
Sbjct: 62  QVVTSGGIVGRVVKATDGTPEVEVEIAPNVKVIVLRDTIASVVN 105


>gi|329298300|ref|ZP_08255636.1| preprotein translocase subunit YajC [Plautia stali symbiont]
          Length = 110

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 53/92 (57%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
            S  SP  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+VG+V +
Sbjct: 15  PSQGSPYSLVIMLVVFGLIFYFMILRPQQKRAKDHKKLMDSISKGDEVLTNGGLVGRVTK 74

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +   + + + +   V + R FV+ V  K  
Sbjct: 75  MAETGYIAIALNDTTEVVIKRDFVAAVLPKGT 106


>gi|261822533|ref|YP_003260639.1| preprotein translocase subunit YajC [Pectobacterium wasabiae
           WPP163]
 gi|261606546|gb|ACX89032.1| preprotein translocase, YajC subunit [Pectobacterium wasabiae
           WPP163]
          Length = 109

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 57/105 (54%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   A +  P      SP  M  +  V  +++YF+++RPQ+++ +   +++ ++ +GD 
Sbjct: 5   ISDAVAATGTPPQ----SPYTMVIMLAVFGLIFYFMILRPQQKRGKEHKKLMDSISKGDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T+ G+VG+V +V +   + + + E   V + R FV+ V  K  
Sbjct: 61  VLTSGGLVGRVTKVSETGYIAIALNETNEVVIKRDFVAAVLPKGT 105


>gi|209695858|ref|YP_002263788.1| preprotein translocase subunit YajC [Aliivibrio salmonicida
           LFI1238]
 gi|208009811|emb|CAQ80118.1| putative membrane subunit of preprotein translocase [Aliivibrio
           salmonicida LFI1238]
          Length = 110

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL- 79
           ++M  +  + AV++YF++ RPQ ++ +    ++ ++ +GD ++TA G+VGK+ +  D+  
Sbjct: 20  MQMFIMLGMFAVIFYFMIYRPQAKRQKEHKNLMSSMGKGDEVLTAGGLVGKITKASDEND 79

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + FVS V  K  
Sbjct: 80  YIVIELNANNEVTIKKDFVSAVLPKGT 106


>gi|194365394|ref|YP_002028004.1| preprotein translocase subunit YajC [Stenotrophomonas maltophilia
           R551-3]
 gi|194348198|gb|ACF51321.1| preprotein translocase, YajC subunit [Stenotrophomonas maltophilia
           R551-3]
          Length = 114

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                L       +L  + YFL+IRPQ ++ +    ML  ++RGD ++T  GI GKV  +
Sbjct: 20  PQGMGLTTLLFPVILIAIMYFLMIRPQMKRQKEHKSMLEKIKRGDEVLTNGGIAGKVTDI 79

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D  + +E+AENVR+RV +  V  V     
Sbjct: 80  -GDNFVTIEVAENVRIRVQKGAVGSVLPTGT 109


>gi|163793143|ref|ZP_02187119.1| preprotein translocase, YajC subunit [alpha proteobacterium BAL199]
 gi|159181789|gb|EDP66301.1| preprotein translocase, YajC subunit [alpha proteobacterium BAL199]
          Length = 140

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 62/92 (67%), Gaps = 1/92 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           +  +       ++  V+YFLLIRPQ+++ +   EML N+RR D IVT  G+VG V++V +
Sbjct: 18  SDMIMSLAPLVLIFAVFYFLLIRPQQKKAKEHREMLGNVRRNDKIVTNGGLVGTVIKVSE 77

Query: 78  -DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            D  L VEIA  V+V+VVRS +++V++K +PV
Sbjct: 78  GDDLLTVEIASGVKVQVVRSMIADVRTKGQPV 109


>gi|294010573|ref|YP_003544033.1| preprotein translocase subunit YajC [Sphingobium japonicum UT26S]
 gi|292673903|dbj|BAI95421.1| preprotein translocase subunit YajC [Sphingobium japonicum UT26S]
          Length = 111

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +AQ+     + A S L       ++ VV+YFLLIRPQ+++++     +  +++GD 
Sbjct: 3   ISPAFAQTAGGESSGA-SMLVQMAPLVLIFVVFYFLLIRPQQKKMKEHKAKIDAVKKGDQ 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G+VGKVVRV D+   +VE+A  ++V+ V+S +++V   + 
Sbjct: 62  VVTGGGLVGKVVRV-DEFYADVELAPGMKVKAVKSTLTDVIDPAT 105


>gi|311694371|gb|ADP97244.1| preprotein translocase, YajC subunit [marine bacterium HP15]
          Length = 120

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 2/103 (1%)

Query: 4   TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
              A +  PA       +     F    +++YFL+ RPQ ++ +    ++  L +GD +V
Sbjct: 16  PALAMAQDPAAQGMG-VMGQVIFFAGFILIFYFLIWRPQSKRAKEHKALMSGLNKGDEVV 74

Query: 64  TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           T+ G+ GK+ +V DD  + VE+A+NV ++V +  V+    K  
Sbjct: 75  TSGGVAGKITKVTDDF-IVVEVADNVEIKVQKVAVAAALPKGT 116


>gi|224826516|ref|ZP_03699617.1| preprotein translocase, YajC subunit [Lutiella nitroferrum 2002]
 gi|224601117|gb|EEG07299.1| preprotein translocase, YajC subunit [Lutiella nitroferrum 2002]
          Length = 106

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +A   AP        L       V+  +++FLL+RPQ+++ + +  ML  + +GD 
Sbjct: 3   ITPAFAAGTAP----GGFDLMGFLPMVVIFALFWFLLVRPQQKRAKEQQRMLSEIAKGDE 58

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVG+V +  +   L VEIA  V V++ R  VS    K  
Sbjct: 59  VVTQGGIVGRVTKAGE-QYLSVEIANGVEVQIQRGAVSAKLEKGT 102


>gi|307294960|ref|ZP_07574802.1| preprotein translocase, YajC subunit [Sphingobium chlorophenolicum
           L-1]
 gi|306879434|gb|EFN10652.1| preprotein translocase, YajC subunit [Sphingobium chlorophenolicum
           L-1]
          Length = 111

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++ +AQ+     + A S L       ++ VV+YFLLIRPQ+++++     +  +++GD 
Sbjct: 3   ISSAFAQTAGGESSGA-SMLVQMAPLLLIFVVFYFLLIRPQQKKMKEHKAKIDAVKKGDQ 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G+VGKVVRV D+   EVE+A  ++V+ V+S +++V   + 
Sbjct: 62  VVTGGGLVGKVVRV-DEFYAEVELAPGMKVKAVKSTLTDVIDPAT 105


>gi|255321129|ref|ZP_05362295.1| preprotein translocase, YajC subunit [Acinetobacter radioresistens
           SK82]
 gi|262380182|ref|ZP_06073337.1| preprotein translocase subunit [Acinetobacter radioresistens SH164]
 gi|255301683|gb|EET80934.1| preprotein translocase, YajC subunit [Acinetobacter radioresistens
           SK82]
 gi|262298376|gb|EEY86290.1| preprotein translocase subunit [Acinetobacter radioresistens SH164]
          Length = 109

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 55/106 (51%), Gaps = 4/106 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +T +A   APA     S +    +  V   ++YFL+ RPQ ++ +    ++ +L  G 
Sbjct: 4   LISTAHA---APAAQQGPSMMANLLMIAVFIAIFYFLIWRPQAKRAKEHRTLVESLGVGS 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +V A G++G++ ++  D  + VE++  V V++ R+ V  V  +  
Sbjct: 61  EVVFAGGLMGRITKLEGDFAV-VELSRGVDVKIQRASVISVLPEGT 105


>gi|194335379|ref|YP_002017173.1| preprotein translocase, YajC subunit [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194307856|gb|ACF42556.1| preprotein translocase, YajC subunit [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 58/106 (54%), Gaps = 1/106 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
              +   +   A  +A +PL       ++ +V+YF +IRPQ+++ + R ++L +L+RGD 
Sbjct: 5   IQPLLLFAPPVAGQAAPNPLIQIVPLVLIFIVFYFFMIRPQQKKQKDREKVLDSLKRGDK 64

Query: 62  IVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G  G V  +  +   + V+++E  +++  R+ ++ ++ +  
Sbjct: 65  VVTIGGAHGTVAGIDTEKKTVLVQVSETTKIKFDRTAIANIEKQET 110


>gi|90419391|ref|ZP_01227301.1| putative preprotein translocase, YajC subunit [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336328|gb|EAS50069.1| putative preprotein translocase, YajC subunit [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 112

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 72/108 (66%), Gaps = 3/108 (2%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF T  +AQ+ + A    +  L     F  +  + YFL+IRPQR  +++R EML+N+RRG
Sbjct: 1   MFVTEAFAQTGSVA--GGSDLLISVLPFVAVFAIMYFLIIRPQRTAMKKREEMLKNIRRG 58

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D++VT  GIVGKV +V D  ELEV+I+E  RVRV++  V++V+ K EP
Sbjct: 59  DTVVTGGGIVGKVTKVHDSGELEVQISEQTRVRVMQGTVADVRVKGEP 106


>gi|126725450|ref|ZP_01741292.1| preprotein translocase, YajC subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126704654|gb|EBA03745.1| preprotein translocase, YajC subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 105

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/86 (40%), Positives = 63/86 (73%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
               +F ++  + YFLL RPQ+++++   +M+ +L +GD++VT+ G++GKVV+V +  E+
Sbjct: 18  SQLFMFLIIGAIMYFLLFRPQQKKMKEHRKMVDSLAKGDNVVTSGGLIGKVVKVKEGNEI 77

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEP 107
           EVEI++ V VRVV+  +++V SK+EP
Sbjct: 78  EVEISKGVTVRVVQQTITQVLSKTEP 103


>gi|149191584|ref|ZP_01869830.1| preprotein translocase subunit YajC [Vibrio shilonii AK1]
 gi|148834602|gb|EDL51593.1| preprotein translocase subunit YajC [Vibrio shilonii AK1]
          Length = 109

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                 EM  +  + AV++YF++ RPQ ++ +    ++ ++ +GD ++T  G++GK+ ++
Sbjct: 14  PQGGGFEMLIMLGMFAVIFYFMIYRPQAKRAKEHKNLMASMGKGDEVLTNGGLIGKITKI 73

Query: 76  IDDL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +D   + + + +N  V + + FV+ V  K  
Sbjct: 74  AEDNDYIAIALNDNNEVVIKKDFVTAVLPKGT 105


>gi|330814104|ref|YP_004358343.1| preprotein translocase subunit YajC [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487199|gb|AEA81604.1| preprotein translocase subunit YajC [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 93

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 65/87 (74%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       ++ V++YFLLIRPQ+++++    M+ ++ RGD +V + G++GK+VRV++D +
Sbjct: 6   IGQFVPLILIFVIFYFLLIRPQQRKVKEHKAMVDSVARGDMVVASGGLMGKIVRVLEDDK 65

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +E+EI++NV V+V+RS +S V SK+EP
Sbjct: 66  VELEISDNVIVKVIRSSISAVVSKTEP 92


>gi|167564029|ref|ZP_02356945.1| preprotein translocase, YajC subunit [Burkholderia oklahomensis
           EO147]
 gi|167571175|ref|ZP_02364049.1| preprotein translocase, YajC subunit [Burkholderia oklahomensis
           C6786]
          Length = 108

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++  V YF++IRPQ ++ +    ML  + +GD +VT+ G+VGKV +V + 
Sbjct: 18  SSLMSFLPLILMFAVLYFIMIRPQMKRQKEHRSMLAAMAKGDEVVTSGGLVGKVTKVSEA 77

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             + VEIAE   + V ++ V+ +  K  
Sbjct: 78  -YIGVEIAEGTEITVQKAAVTTILPKGT 104


>gi|87200090|ref|YP_497347.1| protein translocase subunit yajC [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135771|gb|ABD26513.1| protein translocase subunit yajC [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 109

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           S A A                +  +++FL++RPQ +Q +     +  +++GD +VTA G+
Sbjct: 7   SAAAANAGEPPAWMSFLPLVAMGFIFWFLILRPQMRQQKEHKAKISAMKKGDMVVTAGGL 66

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           +GKVV++ DD  +E+E+  NV+V+ VR+ + ++  
Sbjct: 67  IGKVVKL-DDHYVELELGPNVKVKAVRATIGDIVP 100


>gi|206889675|ref|YP_002248129.1| preprotein translocase, YajC subunit [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741613|gb|ACI20670.1| preprotein translocase, YajC subunit [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 116

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 1   MFTTVYAQSDAPAI----TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNL 56
           + T  +A   AP          S +       ++ VV+YFLLIRPQ+++ +   +ML NL
Sbjct: 6   LITDAFAMGPAPQGGGQGDPIMSLVASLLPLVLIIVVFYFLLIRPQQKRAKEHRQMLENL 65

Query: 57  RRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +RGD ++T  G+ G V  V     + +++AENV+++  +  ++ ++  ++
Sbjct: 66  KRGDKVITVGGLYGVVDSVNP-NTVILKVAENVKLKFSKQSIAALRPATD 114


>gi|171057034|ref|YP_001789383.1| preprotein translocase subunit YajC [Leptothrix cholodnii SP-6]
 gi|170774479|gb|ACB32618.1| preprotein translocase, YajC subunit [Leptothrix cholodnii SP-6]
          Length = 127

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             S L       ++ VV YF++IRPQ+++ +    M+  + +GD IVT+ G++GKV ++ 
Sbjct: 37  GGSSLMSMLPLVLMFVVLYFIMIRPQQKRAKEHKAMIDAIGKGDEIVTSGGLLGKVTKI- 95

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            D  L +EIA  V  +  R  V +V  K  
Sbjct: 96  GDNYLSIEIANGVEAQCQRGSVIQVLPKGT 125


>gi|146276507|ref|YP_001166666.1| preprotein translocase, YajC subunit [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554748|gb|ABP69361.1| protein translocase subunit yajC [Rhodobacter sphaeroides ATCC
           17025]
          Length = 109

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/86 (47%), Positives = 61/86 (70%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
                  ++ V+ YFLLIRPQ+++L+    M+  LRRGD ++T  GIVGKVV+V +D  +
Sbjct: 21  TSFVPLILIFVIMYFLLIRPQQKKLKEHKAMVEALRRGDQVLTGGGIVGKVVKVHEDGII 80

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEP 107
           +VEIAE V+VRV++S + +V SK+EP
Sbjct: 81  DVEIAEGVKVRVMKSTIVQVMSKTEP 106


>gi|241766126|ref|ZP_04764035.1| preprotein translocase, YajC subunit [Acidovorax delafieldii 2AN]
 gi|241363830|gb|EER59160.1| preprotein translocase, YajC subunit [Acidovorax delafieldii 2AN]
          Length = 140

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            S L       ++ VV YF++IRPQ ++ +    M+  + +GD + TA GI+GKV R+ +
Sbjct: 51  MSSLTGMLPLVLMFVVLYFVMIRPQMKRQKEHRAMIDAIAKGDEVATAGGIIGKVTRLSE 110

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
              L +EIA  V V+V RS V++V  K  
Sbjct: 111 GF-LHIEIASGVEVQVQRSAVAQVLPKGT 138


>gi|167463101|ref|ZP_02328190.1| hypothetical protein Plarl_11137 [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 104

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 8   QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAG 67
           Q  A         L   G   ++ VV YFLLIRPQ+++ + R  ML NL++GD +VT  G
Sbjct: 3   QLAAAQQAGGMGFLFTYGPLILMFVVLYFLLIRPQQKRQKARNLMLSNLKKGDKVVTIGG 62

Query: 68  IVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           + G +V + DD  + + + +  ++   R  V+ V + +
Sbjct: 63  LHGSIVEITDD-VVVLRVNDTTKLTFDRGSVNTVVNST 99


>gi|163749709|ref|ZP_02156955.1| preprotein translocase subunit YajC [Shewanella benthica KT99]
 gi|161330522|gb|EDQ01480.1| preprotein translocase subunit YajC [Shewanella benthica KT99]
          Length = 108

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 57/105 (54%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA   +         +E+  +  +  +++YF++ RPQ ++++ +  ++ +L +GD 
Sbjct: 3   ISNAYAADASA----TGGTMELIFMLVIFGLIFYFMIFRPQSKRVKEQKNLMGSLSKGDE 58

Query: 62  IVTAAGIVGKVVRVID-DLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++T+ GI+GK+ ++ + +  + + I E   + + + +++ +  K 
Sbjct: 59  VLTSGGILGKIAKISEGNDYVLLTINETSEITIKKDYIAAILPKG 103


>gi|325577687|ref|ZP_08147962.1| preprotein translocase [Haemophilus parainfluenzae ATCC 33392]
 gi|301154786|emb|CBW14249.1| SecYEG protein translocase auxillary subunit [Haemophilus
           parainfluenzae T3T1]
 gi|325160432|gb|EGC72558.1| preprotein translocase [Haemophilus parainfluenzae ATCC 33392]
          Length = 96

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 52/89 (58%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           A SP+    +F +  +++YF++ RPQ ++ +   +++  L +G  ++TA G++GK+ +V 
Sbjct: 3   AQSPMSTLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLTAGGLIGKITKVT 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +  E+ + + +   + + R+++  V  K 
Sbjct: 63  EGAEIVIALNDTTEITINRNYIVSVLPKG 91


>gi|152978724|ref|YP_001344353.1| preprotein translocase subunit YajC [Actinobacillus succinogenes
           130Z]
 gi|150840447|gb|ABR74418.1| preprotein translocase, YajC subunit [Actinobacillus succinogenes
           130Z]
          Length = 99

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               SP+ M  +F +  +++YF++ RPQ ++ +    ++ +L +G  ++TA GIVGK+ +
Sbjct: 3   AQQGSPMSMLIIFAIFGLIFYFMIYRPQAKRTKEHKNLMASLSKGAEVLTAGGIVGKISK 62

Query: 75  VIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
           + +   E+ +++ EN  + + R++V+ V  K 
Sbjct: 63  ITEGSNEIVIQLNENTEITIHRNYVAAVLPKG 94


>gi|149375023|ref|ZP_01892796.1| preprotein translocase, YajC subunit [Marinobacter algicola DG893]
 gi|149360912|gb|EDM49363.1| preprotein translocase, YajC subunit [Marinobacter algicola DG893]
          Length = 120

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M     AQ    A       +     F    +++YFL+ RPQ ++ +    ++  L +GD
Sbjct: 15  MPALAMAQD---AGAQGMGVMGQVIFFAGFILIFYFLIWRPQSKRAKEHKALMAGLNKGD 71

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +VT+ G+ GK+ +V DD  + VEIA+NV V+V +  V+    K  
Sbjct: 72  EVVTSGGVAGKITKVSDDF-IVVEIADNVEVKVQKVAVAAALPKGT 116


>gi|182677986|ref|YP_001832132.1| preprotein translocase, YajC subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633869|gb|ACB94643.1| preprotein translocase, YajC subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 111

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 67/90 (74%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
             +     F ++ ++ YFL+IRPQ+++ +  A++L+N+RRGD +V   G++GKV ++ D+
Sbjct: 18  DIILQVAPFGLILIIMYFLIIRPQQKRAKEHADLLKNIRRGDMVVMTGGLIGKVSKISDE 77

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            E+E+EIA NV+VRVVR+ ++EV+SK EPV
Sbjct: 78  AEVELEIAPNVKVRVVRTMIAEVRSKGEPV 107


>gi|269468359|gb|EEZ80030.1| preprotein translocase subunit YajC [uncultured SUP05 cluster
           bacterium]
          Length = 111

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/104 (32%), Positives = 58/104 (55%), Gaps = 4/104 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA+    A   +   L       V+ V+ YFLLIRPQ+++ +    +L  L++GD 
Sbjct: 8   ISPAYAEGVELAGAGSLGGLP---FLAVMFVLMYFLLIRPQQKRAKEHKNLLSELKKGDE 64

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           IVT  G++GKV+ V D+    +EIA++V V+V +  +++   K 
Sbjct: 65  IVTNGGVIGKVMSV-DESFATLEIAKDVVVKVQKQGINQKLPKG 107


>gi|261868464|ref|YP_003256386.1| preprotein translocase subunit YajC [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413796|gb|ACX83167.1| preprotein translocase subunit YajC [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 99

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 56/93 (60%), Gaps = 1/93 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           T   SP+ M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++TA GI+GK+ +
Sbjct: 3   TQQGSPMSMLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLTAGGIIGKITK 62

Query: 75  VIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++++   + + + ++  V + R++++ V  K  
Sbjct: 63  MVENSDNIVIALNDSTEVTINRNYIAAVLPKGT 95


>gi|298372911|ref|ZP_06982901.1| preprotein translocase, YajC subunit [Bacteroidetes oral taxon
          274 str. F0058]
 gi|298275815|gb|EFI17366.1| preprotein translocase, YajC subunit [Bacteroidetes oral taxon
          274 str. F0058]
          Length = 111

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 3/97 (3%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M +T+  Q  A    +  S      +F +L VV+YF LIRPQ ++ +   +   +L  G 
Sbjct: 1  MLSTILLQ--AQTQGAGGSMWSTILMFALLIVVFYFFLIRPQSKRQKEVRKFQDSLENGK 58

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSF 97
          S++T  GI GK+  V  D  + +EIAE V+++V ++ 
Sbjct: 59 SVITQGGIYGKIKEVK-DNYVILEIAEGVKIKVNKNM 94


>gi|21672416|ref|NP_660483.1| hypothetical protein BUsg126 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25009583|sp|Q8KA08|Y126_BUCAP RecName: Full=UPF0092 membrane protein BUsg_126
 gi|21623026|gb|AAM67694.1| hypothetical 11.9 kDa protein [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 110

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 48/99 (48%)

Query: 8   QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAG 67
            + A       +   +  +     +++YF+L RPQ+++ +    ++ ++  GD ++T +G
Sbjct: 8   ANAAVNQALEGNSYSLIFMLVTFILIFYFMLFRPQQKKDKEHKNLMNSIAPGDEVMTTSG 67

Query: 68  IVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +G+V +V ++  + +++     + + + F+     K  
Sbjct: 68  FLGRVKKVTENGYVLLQLNNTTEIFIKKDFIVSSLPKGT 106


>gi|296446022|ref|ZP_06887972.1| preprotein translocase, YajC subunit [Methylosinus trichosporium
           OB3b]
 gi|296256540|gb|EFH03617.1| preprotein translocase, YajC subunit [Methylosinus trichosporium
           OB3b]
          Length = 156

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 65/89 (73%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +        + ++ YF+++RPQ ++ + + E L+N+RRGD++VT  G+VGKV + IDD 
Sbjct: 61  SMMQFVPLLFITLIVYFIVLRPQNRRAKEQKEALKNVRRGDTVVTTGGLVGKVTKTIDDA 120

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           E+EVEIA+NVRVR+VR  +S+V++K EPV
Sbjct: 121 EVEVEIAQNVRVRIVRQAISDVRAKGEPV 149


>gi|260913704|ref|ZP_05920180.1| preprotein translocase [Pasteurella dagmatis ATCC 43325]
 gi|260632243|gb|EEX50418.1| preprotein translocase [Pasteurella dagmatis ATCC 43325]
          Length = 96

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 53/91 (58%), Gaps = 1/91 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               SP+ M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++TA G++G++ +
Sbjct: 3   AQQGSPMSMLFIFVLFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLTAGGLIGRITK 62

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           V DD  + + + ++  V + R++V  +  K 
Sbjct: 63  VTDDS-IVIALNDSTEVTINRNYVVAILPKG 92


>gi|209520462|ref|ZP_03269222.1| preprotein translocase, YajC subunit [Burkholderia sp. H160]
 gi|295675563|ref|YP_003604087.1| preprotein translocase, YajC subunit [Burkholderia sp. CCGE1002]
 gi|209499107|gb|EDZ99202.1| preprotein translocase, YajC subunit [Burkholderia sp. H160]
 gi|295435406|gb|ADG14576.1| preprotein translocase, YajC subunit [Burkholderia sp. CCGE1002]
          Length = 109

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 48/88 (54%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++  V YF++IRPQ ++ +    ML  + +GD +VT  GIVGKV +V + 
Sbjct: 19  SNLMSFLPLILMFGVLYFIMIRPQMKRQKEHRNMLAAMAKGDEVVTNGGIVGKVTKVGEA 78

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             + +EI+E   + V ++ V+ +  K  
Sbjct: 79  -YVGIEISEGTEITVQKASVTTILPKGT 105


>gi|290474704|ref|YP_003467584.1| preprotein translocase auxillary membrane protein [Xenorhabdus
           bovienii SS-2004]
 gi|289174017|emb|CBJ80804.1| preprotein translocase, auxillary membrane component (General
           Secretory Pathway) [Xenorhabdus bovienii SS-2004]
          Length = 112

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 52/87 (59%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
           P  +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T+ G+VG+V +V +  
Sbjct: 22  PYSLIIMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTSGGLVGRVSKVSETG 81

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + V + +   + V R FV+ +  K  
Sbjct: 82  YVVVALNDTTEITVKRDFVAAILPKGT 108


>gi|21243245|ref|NP_642827.1| preprotein translocase subunit YajC [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|78048250|ref|YP_364425.1| preprotein translocase subunit YajC [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294624100|ref|ZP_06702845.1| preprotein translocase subunit YajC [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664104|ref|ZP_06729499.1| preprotein translocase subunit YajC [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325927084|ref|ZP_08188354.1| protein translocase subunit yajC (SecM) [Xanthomonas perforans
           91-118]
 gi|21108778|gb|AAM37363.1| preprotein translocase YajC subunit [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|78036680|emb|CAJ24371.1| preprotein translocase subunit YajC [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|292601600|gb|EFF45592.1| preprotein translocase subunit YajC [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292606125|gb|EFF49381.1| preprotein translocase subunit YajC [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325542583|gb|EGD14055.1| protein translocase subunit yajC (SecM) [Xanthomonas perforans
           91-118]
          Length = 117

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    L  +L  V YFL+IRPQ ++ +    +L  L RGD ++T+ G+ G +  +  D  
Sbjct: 28  LSTFALPIILIAVMYFLMIRPQMKRQKEHKALLDKLARGDEVITSGGVAGVITDI-GDNF 86

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + VE+A+NVR+RV +S V  V  K  
Sbjct: 87  ISVEVADNVRIRVQKSAVGHVLPKGT 112


>gi|107103342|ref|ZP_01367260.1| hypothetical protein PaerPA_01004411 [Pseudomonas aeruginosa PACS2]
          Length = 112

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ +    +L NL++GD +VT+ GI GKV +V DD  + VE
Sbjct: 28  VFLVGFLVIFYLMIWRPQAKRAKEHKNLLGNLQKGDEVVTSGGIAGKVTKVADDF-VVVE 86

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++NV ++  ++ ++    K  
Sbjct: 87  VSDNVELKFQKAAIAATLPKGT 108


>gi|49080108|gb|AAT49973.1| PA3822 [synthetic construct]
          Length = 113

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ +    +L NL++GD +VT+ GI GKV +V DD  + VE
Sbjct: 28  VFLVGFLVIFYLMIWRPQAKRAKEHKNLLGNLQKGDEVVTSGGIAGKVTKVADDF-VVVE 86

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++NV ++  ++ ++    K  
Sbjct: 87  VSDNVELKFQKAAIAATLPKGT 108


>gi|15599017|ref|NP_252511.1| preprotein translocase subunit YajC [Pseudomonas aeruginosa PAO1]
 gi|116051847|ref|YP_789310.1| preprotein translocase subunit YajC [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152987118|ref|YP_001346675.1| preprotein translocase subunit YajC [Pseudomonas aeruginosa PA7]
 gi|218889894|ref|YP_002438758.1| preprotein translocase subunit YajC [Pseudomonas aeruginosa LESB58]
 gi|254236726|ref|ZP_04930049.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254242513|ref|ZP_04935835.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296387662|ref|ZP_06877137.1| preprotein translocase subunit YajC [Pseudomonas aeruginosa PAb1]
 gi|313109240|ref|ZP_07795208.1| putative preprotein translocase [Pseudomonas aeruginosa 39016]
 gi|9949996|gb|AAG07209.1|AE004799_15 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115587068|gb|ABJ13083.1| putative preprotein translocase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168657|gb|EAZ54168.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126195891|gb|EAZ59954.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|150962276|gb|ABR84301.1| preprotein translocase, YajC subunit [Pseudomonas aeruginosa PA7]
 gi|218770117|emb|CAW25879.1| putative preprotein translocase [Pseudomonas aeruginosa LESB58]
 gi|310881710|gb|EFQ40304.1| putative preprotein translocase [Pseudomonas aeruginosa 39016]
          Length = 112

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ +    +L NL++GD +VT+ GI GKV +V DD  + VE
Sbjct: 28  VFLVGFLVIFYLMIWRPQAKRAKEHKNLLGNLQKGDEVVTSGGIAGKVTKVADDF-VVVE 86

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++NV ++  ++ ++    K  
Sbjct: 87  VSDNVELKFQKAAIAATLPKGT 108


>gi|104780221|ref|YP_606719.1| preprotein translocase subunit YajC [Pseudomonas entomophila L48]
 gi|95109208|emb|CAK13905.1| preprotein translocase, membrane subunit YajC [Pseudomonas
           entomophila L48]
          Length = 111

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L NL++GD +VT  GI GK+V+V DD  + +E
Sbjct: 27  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLSNLQKGDEVVTNGGIAGKIVKVSDDF-VVLE 85

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++NV ++  +  ++    K  
Sbjct: 86  VSDNVELKFQKGAIAATLPKGT 107


>gi|295111466|emb|CBL28216.1| preprotein translocase, YajC subunit [Synergistetes bacterium SGP1]
          Length = 140

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/98 (36%), Positives = 51/98 (52%), Gaps = 4/98 (4%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
              A     S + M     +  V++YF +IRPQR++ +    +L  + RGD IVT  G +
Sbjct: 35  GGAAPQQQASLMGMLFPLVIFVVIFYFFIIRPQRKRQKEHESLLSGIGRGDQIVTIGGFL 94

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           G V  V DD  L +E+ E VRVR++RS V     K  P
Sbjct: 95  GTVKEVRDDTFL-IEMGEGVRVRILRSAVQT---KRTP 128


>gi|95929299|ref|ZP_01312043.1| preprotein translocase, YajC subunit [Desulfuromonas acetoxidans
           DSM 684]
 gi|95134797|gb|EAT16452.1| preprotein translocase, YajC subunit [Desulfuromonas acetoxidans
           DSM 684]
          Length = 103

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 59/100 (59%), Gaps = 2/100 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +  YA +  PA     S  E   +  ++  ++Y LLIRPQ+++ ++  ++L  L+ GD
Sbjct: 1   MVSEAYAMAGQPAAGGQ-SGYEGIIMLVIMFAIFYLLLIRPQQKRAKQHRQLLDALKAGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
            +VTA GI G++V V +   + +EI + V++++ R+ V+ 
Sbjct: 60  QVVTAGGIHGRIVTVQE-NVVTMEIDKGVKIKLNRASVTA 98


>gi|298530967|ref|ZP_07018368.1| preprotein translocase, YajC subunit [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298508990|gb|EFI32895.1| preprotein translocase, YajC subunit [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 112

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 57/99 (57%), Gaps = 2/99 (2%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           T ++A    P    A +PL       ++  ++YFLLIRPQ+++ +    +L NL+RGD++
Sbjct: 5   TMIFAMGADP-EGGAGNPLAAFVPLILMFAIFYFLLIRPQQKKAKEHRNVLANLKRGDNV 63

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           +T  G+  ++  + +D  L +E+ +   ++  R++++ +
Sbjct: 64  LTNGGVYARISDIQND-VLTLEVGDKTTIKANRNYIAGL 101


>gi|300690472|ref|YP_003751467.1| protein translocase auxillary subunit [Ralstonia solanacearum
           PSI07]
 gi|299077532|emb|CBJ50158.1| protein translocase auxillary subunit [Ralstonia solanacearum
           PSI07]
          Length = 88

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
                  ++ VV +F++IRPQ ++ +    ML  L +GD +VTA GI+GKV +V  D  +
Sbjct: 1   MSFLPIILMFVVLWFIMIRPQMKRQKETKTMLEALAKGDEVVTAGGILGKVTKVA-DQYV 59

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSE 106
            VE+A N  V V ++ V+ V  K  
Sbjct: 60  TVEVAPNTEVTVQKNAVTTVLPKGT 84


>gi|127513264|ref|YP_001094461.1| preprotein translocase, YajC subunit [Shewanella loihica PV-4]
 gi|126638559|gb|ABO24202.1| protein translocase subunit yajC [Shewanella loihica PV-4]
          Length = 91

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL- 79
           +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD ++T+ GI+GK+ ++ DD  
Sbjct: 1   MELVFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLSKGDEVLTSGGILGKIAKISDDND 60

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKS 105
            + + I E   + + + +++ V  K 
Sbjct: 61  YVLLTINETSEITIKKDYIAAVLPKG 86


>gi|145594355|ref|YP_001158652.1| preprotein translocase, YajC subunit [Salinispora tropica CNB-440]
 gi|145303692|gb|ABP54274.1| protein translocase subunit yajC [Salinispora tropica CNB-440]
          Length = 111

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  ++ S      +  +L  V YF++IRPQ+++ +  A M  +L  GD +VT  G+ G V
Sbjct: 4   AQENSASNFTPILMIVLLFGVMYFMMIRPQQKRRREAANMQSSLGHGDEVVTIGGLYGTV 63

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             V DD  + +E+A  V  R  R  ++ V +K+E
Sbjct: 64  TGV-DDETVLLEVAPGVETRYARPAIARVVTKAE 96


>gi|34540301|ref|NP_904780.1| preprotein translocase subunit YajC [Porphyromonas gingivalis
          W83]
 gi|188995349|ref|YP_001929601.1| hypothetical protein PGN_1485 [Porphyromonas gingivalis ATCC
          33277]
 gi|34396613|gb|AAQ65679.1| preprotein translocase, YajC subunit [Porphyromonas gingivalis
          W83]
 gi|188595029|dbj|BAG34004.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC
          33277]
          Length = 112

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 5  VYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVT 64
          ++ Q+   A        +M  +  ++ V++YF +IRPQ+++ +        L +GD I+T
Sbjct: 4  IFLQAAPQAGGLFGGSSQMILVLVLMVVIFYFFMIRPQQKRQKELQRQREALAKGDKIIT 63

Query: 65 AAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
          A GI G +  V +   L VEIA  V +R+ +  V
Sbjct: 64 AGGIHGTIREVREKDFL-VEIANGVNIRIDKGSV 96


>gi|146308534|ref|YP_001188999.1| preprotein translocase subunit YajC [Pseudomonas mendocina ymp]
 gi|145576735|gb|ABP86267.1| protein translocase subunit yajC [Pseudomonas mendocina ymp]
          Length = 109

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
             A S  E         V++Y ++ RPQ ++ +    +L +L++GD +VT+ GI GKV +
Sbjct: 16  GPAGSGFE-WVFLIGFLVIFYLMIWRPQAKRAKEHKNLLSSLQKGDEVVTSGGIAGKVSK 74

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           V DD  + +E+++ V ++  +  ++    K  
Sbjct: 75  VADDF-VVIEVSDTVELKFQKQAIAATLPKGT 105


>gi|88703391|ref|ZP_01101107.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88702105|gb|EAQ99208.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 110

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L        L V++YF+ IRPQR++ +  A M+  L +GD +VT++GI+GK+V + DD  
Sbjct: 21  LFQIIFLVGLFVLFYFIAIRPQRKRQKEHAAMVAALGKGDEVVTSSGILGKIVSL-DDNY 79

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + + ++E V ++  R  +  V  K  
Sbjct: 80  VVLNVSEKVELKFQRVHIHAVLPKGT 105


>gi|121998476|ref|YP_001003263.1| preprotein translocase subunit YajC [Halorhodospira halophila SL1]
 gi|121589881|gb|ABM62461.1| protein translocase subunit yajC [Halorhodospira halophila SL1]
          Length = 114

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +      L   +  ++YFLLIRPQ ++ +   +M+  L +GD +VT  G +G++  V  
Sbjct: 18  PNVWFSIILLVGMIALFYFLLIRPQTKRAKEHRQMVEELSKGDEVVTNGGTLGRITEV-G 76

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D    +E+A  V++++ ++ V+ V  K  
Sbjct: 77  DTFATIEVANGVQLQIQKNAVASVMPKGT 105


>gi|269103293|ref|ZP_06155990.1| preprotein translocase subunit YajC [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163191|gb|EEZ41687.1| preprotein translocase subunit YajC [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 112

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S +++  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T  G++G++ +V
Sbjct: 17  PQGSSMQLFIMLGLFAVIFYFMIYRPQAKRVKEHKNLMASMGKGDEVLTNGGLLGRITKV 76

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             +   + + + ++  V + + FV+ V  K  
Sbjct: 77  SAESDYIVIALNDSTEVTIKKDFVTAVLPKGT 108


>gi|294677318|ref|YP_003577933.1| preprotein translocase subunit YajC [Rhodobacter capsulatus SB
           1003]
 gi|294476138|gb|ADE85526.1| preprotein translocase, YajC subunit [Rhodobacter capsulatus SB
           1003]
          Length = 111

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 61/85 (71%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
                 ++ V+ YFLLIRPQ+++ +    M+  LRRGD  +T AGI+GKVV + +D E+E
Sbjct: 23  QFVPLILIFVIMYFLLIRPQQKKAKEHKAMVDALRRGDMGLTQAGIIGKVVHLREDGEIE 82

Query: 83  VEIAENVRVRVVRSFVSEVQSKSEP 107
           VEIA++++VR++RS V +V SK+EP
Sbjct: 83  VEIAKDMKVRMIRSAVVQVLSKTEP 107


>gi|329894867|ref|ZP_08270666.1| Preprotein translocase subunit YajC (TC 3.A.5.1.1) [gamma
           proteobacterium IMCC3088]
 gi|328922596|gb|EGG29931.1| Preprotein translocase subunit YajC (TC 3.A.5.1.1) [gamma
           proteobacterium IMCC3088]
          Length = 114

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L        L V++YF+ IRPQR++ +   E++ NL +GD I+T +GI+G+V ++ D
Sbjct: 19  GGELFQIFFLVGLFVLFYFIAIRPQRKRQKEHQELVSNLAKGDEIITTSGILGRVAKL-D 77

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + V +A+ V ++  R  V  V  K  
Sbjct: 78  DTYMVVTVADKVDMKFQRLHVHAVLPKGT 106


>gi|226941675|ref|YP_002796749.1| transmembrane protein [Laribacter hongkongensis HLHK9]
 gi|226716602|gb|ACO75740.1| probable transmembrane protein [Laribacter hongkongensis HLHK9]
          Length = 92

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 54/85 (63%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L       V+ V+++FLL+RPQ+++++    ML  L++GD +VT AG++G++ ++ DD  
Sbjct: 5   LMSFLPMIVIFVLFWFLLVRPQQKKMKEHKTMLEALQKGDEVVTQAGMIGRITKL-DDNN 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
           + VE+A+NV ++  R+ +     K 
Sbjct: 64  VTVEVAKNVEIQFQRAAIGNKLEKG 88


>gi|159037425|ref|YP_001536678.1| preprotein translocase, YajC subunit [Salinispora arenicola
           CNS-205]
 gi|157916260|gb|ABV97687.1| preprotein translocase, YajC subunit [Salinispora arenicola
           CNS-205]
          Length = 112

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
              +          +  +L  V YF++IRPQ+++ +    M  +L  GD +VT  G+ G 
Sbjct: 4   AQESGGAGGFTPILMIVLLFGVMYFMMIRPQQKRRREATAMQSSLGHGDEVVTIGGLYGT 63

Query: 72  VVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           VV V DD  + +E+A  V+ R  R  ++ V +K+E
Sbjct: 64  VVGV-DDETVLLEVAPGVQSRYARPAIARVVTKAE 97


>gi|222056532|ref|YP_002538894.1| preprotein translocase subunit YajC [Geobacter sp. FRC-32]
 gi|221565821|gb|ACM21793.1| preprotein translocase, YajC subunit [Geobacter sp. FRC-32]
          Length = 106

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 57/104 (54%), Gaps = 4/104 (3%)

Query: 1   MFTTVYAQSDAPAITSAT---SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           MF   +A        +A    S L        +  ++YFLLIRPQ+++ +    +L +L+
Sbjct: 1   MFGLAFAMGTPAGGQAAGGGQSALMNLVPLIFMFAIFYFLLIRPQQKKAKEHRTLLDSLK 60

Query: 58  RGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           +GD ++TA G+ GKV  + D+  + +E+A  V V++ + F++ +
Sbjct: 61  KGDQVITAGGMHGKVTAI-DENVVTLEVATGVNVKINKGFIASL 103


>gi|94263086|ref|ZP_01286905.1| YajC [delta proteobacterium MLMS-1]
 gi|94266354|ref|ZP_01290054.1| YajC [delta proteobacterium MLMS-1]
 gi|93453037|gb|EAT03522.1| YajC [delta proteobacterium MLMS-1]
 gi|93456629|gb|EAT06737.1| YajC [delta proteobacterium MLMS-1]
          Length = 112

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/98 (31%), Positives = 57/98 (58%), Gaps = 5/98 (5%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M +  +A   AP      +         ++ V++YFLLIRPQ+++ +   + L+ L+ GD
Sbjct: 1  MVSIAHAAEAAPPGGGFGA----FIPLILIFVIFYFLLIRPQQKKAKEHQQFLQALKIGD 56

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           ++++ GI G V  + +D E+ +EIA+ VRV+V R ++
Sbjct: 57 KVISSGGIFGTVTAI-EDNEVTLEIADKVRVKVARPYI 93


>gi|126668568|ref|ZP_01739522.1| preprotein translocase, YajC subunit [Marinobacter sp. ELB17]
 gi|126626973|gb|EAZ97616.1| preprotein translocase, YajC subunit [Marinobacter sp. ELB17]
          Length = 120

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A   +   +     F    +++YFL+ RPQ ++ +    ++  L +GD +VT+ G+VGK+
Sbjct: 24  AAGGSMGVMGQVIFFAGFILIFYFLIWRPQSKRAKEHKSLMSGLNKGDEVVTSGGMVGKI 83

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +V DD  + +E+A+NV VR+ +  VS    K 
Sbjct: 84  TKVSDDF-IVLEVADNVSVRIQKVAVSGALPKG 115


>gi|262377441|ref|ZP_06070664.1| preprotein translocase subunit [Acinetobacter lwoffii SH145]
 gi|262307671|gb|EEY88811.1| preprotein translocase subunit [Acinetobacter lwoffii SH145]
          Length = 109

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +T +A   A       S +    +  V   ++YFL+ RPQ ++ +    ++ +L  G  
Sbjct: 5   ISTAHA---AGETAQQPSMMANLLMIAVFIAIFYFLIWRPQSKRAKEHRALVDSLGVGSE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +V A G++GK+ ++  D  + VE++  V V+V R+ V  V  +  
Sbjct: 62  VVFAGGLMGKITKIEGDFAV-VELSRGVEVKVQRASVISVLPEGT 105


>gi|303327874|ref|ZP_07358314.1| preprotein translocase, YajC subunit [Desulfovibrio sp. 3_1_syn3]
 gi|302862235|gb|EFL85169.1| preprotein translocase, YajC subunit [Desulfovibrio sp. 3_1_syn3]
          Length = 110

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
               A  S T  L       ++ V+++FLLIRPQ+++ +    ML  L+RGD ++T++G+
Sbjct: 5   QAGGAPASGTDMLMQFLPLILMFVIFWFLLIRPQQKRAKAHKLMLSELKRGDHVLTSSGL 64

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           +G+++ + DD ++ +E  +  ++R+ R+ +  +  
Sbjct: 65  IGRILEI-DDEQVLLESGD-AKLRISRAAIGGLLP 97


>gi|114046954|ref|YP_737504.1| protein translocase subunit yajC [Shewanella sp. MR-7]
 gi|117919884|ref|YP_869076.1| protein translocase subunit yajC [Shewanella sp. ANA-3]
 gi|113888396|gb|ABI42447.1| protein translocase subunit yajC [Shewanella sp. MR-7]
 gi|117612216|gb|ABK47670.1| protein translocase subunit yajC [Shewanella sp. ANA-3]
          Length = 91

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 53/86 (61%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL- 79
           +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD ++T+ GI+GK+ ++ D+  
Sbjct: 1   MELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLTKGDEVLTSGGILGKIAKISDEND 60

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKS 105
            + + + +  ++ + + +++ V  K 
Sbjct: 61  YVLLSLNDTTQITIKKDYIAAVLPKG 86


>gi|331671955|ref|ZP_08372751.1| preprotein translocase, YajC subunit [Escherichia coli TA280]
 gi|331070944|gb|EGI42303.1| preprotein translocase, YajC subunit [Escherichia coli TA280]
 gi|332761699|gb|EGJ91978.1| preprotein translocase, YajC subunit [Shigella flexneri 2747-71]
          Length = 90

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 52/86 (60%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           + +  +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+VG+V +V ++  
Sbjct: 1   MSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGY 60

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + + + +   V + R FV+ V  K  
Sbjct: 61  IAIALNDTTEVVIKRDFVAAVLPKGT 86


>gi|332530978|ref|ZP_08406901.1| protein translocase subunit yajC [Hylemonella gracilis ATCC 19624]
 gi|332039589|gb|EGI75992.1| protein translocase subunit yajC [Hylemonella gracilis ATCC 19624]
          Length = 110

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               S L       ++ VV YF++IRPQ ++ +    M+  L +GD +VT  G++G+V  
Sbjct: 18  GGLQSSLMSMLPIVLMFVVLYFIMIRPQMKKQKEHRAMVDALAKGDEVVTVGGMLGRVSS 77

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           V  D +L +EIA  V V++ R  V++V  K  
Sbjct: 78  V-GDNQLGLEIASGVEVQIQRHAVAQVLPKGT 108


>gi|119945873|ref|YP_943553.1| preprotein translocase, YajC subunit [Psychromonas ingrahamii 37]
 gi|119864477|gb|ABM03954.1| protein translocase subunit yajC [Psychromonas ingrahamii 37]
          Length = 110

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 58/106 (54%), Gaps = 5/106 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  +A  +  A  S    +    +  V A ++YF++ RPQ ++ +    ++ ++ +GD 
Sbjct: 5   ISEAHAAGEGQATDS----MSFVLMMVVFAAIFYFMIYRPQAKRTKAHKSLMESIGKGDE 60

Query: 62  IVTAAGIVGKVVRV-IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  G++G+VV+V  ++  L++E+ EN  + + + +V+ +  K  
Sbjct: 61  VLTQGGLIGRVVKVNTENDYLQIELNENNIISIKKDYVTAILPKGT 106


>gi|317404683|gb|EFV85075.1| secreted protein [Achromobacter xylosoxidans C54]
          Length = 114

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 9/108 (8%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           + V AQ+ AP      + L       ++ V+ YFL+IRPQ ++ +    ++  L +GD +
Sbjct: 8   SLVVAQAAAPE----GNALMGMLPIILMFVILYFLMIRPQMKRQKEHRNLIAALAKGDEV 63

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAE----NVRVRVVRSFVSEVQSKSE 106
           VTA G++GKV +V +D  + VE++E     V + + +S VS V  K  
Sbjct: 64  VTAGGMLGKVTKV-NDSYVTVEVSELADKPVEIIMQKSSVSTVLPKGT 110


>gi|254452432|ref|ZP_05065869.1| preprotein translocase, YajC subunit [Octadecabacter antarcticus
           238]
 gi|198266838|gb|EDY91108.1| preprotein translocase, YajC subunit [Octadecabacter antarcticus
           238]
          Length = 77

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 60/74 (81%)

Query: 34  WYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRV 93
            YFLLIRPQ+++L++   M+ +LRRGD +VTA G++GKV ++ DD E+EVE+AE V+VRV
Sbjct: 1   MYFLLIRPQQKKLKQHQAMVASLRRGDQVVTAGGLIGKVSKIKDDAEVEVELAEGVKVRV 60

Query: 94  VRSFVSEVQSKSEP 107
           VRS + +V +K+EP
Sbjct: 61  VRSTIGQVLNKTEP 74


>gi|293390418|ref|ZP_06634752.1| preprotein translocase subunit YajC [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290950952|gb|EFE01071.1| preprotein translocase subunit YajC [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 99

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           T   SP+ M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++TA GI+GK+ +
Sbjct: 3   TQQGSPMSMLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLTAGGIIGKITK 62

Query: 75  VIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++++   + + + ++  V + R+++  V  K  
Sbjct: 63  MVENSDNIVIALNDSTEVTINRNYIVAVLPKGT 95


>gi|113869068|ref|YP_727557.1| preprotein translocase subunit YajC [Ralstonia eutropha H16]
 gi|113527844|emb|CAJ94189.1| protein translocase subunit YajC [Ralstonia eutropha H16]
          Length = 108

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +  +  +       A   L       ++  V +F++IRPQ ++ +    ML  L + D
Sbjct: 2   LISNAF--AQTTGTGGAAGGLMSFLPIILMFGVLWFIMIRPQMKRQKEAKAMLEALAKND 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +VTA GI+GKV +V  D  + +EIAE   + V ++ V+ V  K 
Sbjct: 60  EVVTAGGILGKVTKVT-DQYVSLEIAEGTEITVQKNAVTTVLPKG 103


>gi|126732590|ref|ZP_01748387.1| preprotein translocase, YajC subunit [Sagittula stellata E-37]
 gi|126706874|gb|EBA05943.1| preprotein translocase, YajC subunit [Sagittula stellata E-37]
          Length = 95

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 63/89 (70%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + L    +  ++  + YFLLIRPQ+++++    M+  +RR D IVT  GI+ KVV+V DD
Sbjct: 4   NALSSFVMMGLIFAIMYFLLIRPQQKKVKEHKAMIEAVRRNDIIVTQGGIIAKVVKVKDD 63

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            ELEVEIA+ V+VR++RS ++ V+SK+EP
Sbjct: 64  AELEVEIADGVKVRIMRSTIAAVKSKTEP 92


>gi|56417076|ref|YP_154150.1| preprotein translocase subunit [Anaplasma marginale str. St.
           Maries]
 gi|222475442|ref|YP_002563859.1| preprotein translocase subunit (yajC) [Anaplasma marginale str.
           Florida]
 gi|56388308|gb|AAV86895.1| preprotein translocase subunit [Anaplasma marginale str. St.
           Maries]
 gi|222419580|gb|ACM49603.1| preprotein translocase subunit (yajC) [Anaplasma marginale str.
           Florida]
          Length = 168

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 57/91 (62%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              + +       ++ +++YFL+IRPQ+++L+   ++L ++++GD ++ + G+ G V +V
Sbjct: 59  GLGASIAGFAPLVLIFLIFYFLVIRPQQKKLREHNKLLDSIKKGDKVIASGGLFGTVTKV 118

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
              +  L +EIA  V VRV++S VSEV ++ 
Sbjct: 119 DASNGHLHIEIATGVEVRVLKSSVSEVLNRD 149


>gi|103487200|ref|YP_616761.1| preprotein translocase, YajC subunit [Sphingopyxis alaskensis
           RB2256]
 gi|98977277|gb|ABF53428.1| protein translocase subunit yajC [Sphingopyxis alaskensis RB2256]
          Length = 178

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 2/88 (2%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
             M   + ++  V++F LIRPQ+ + +     +  ++  D +VT  GIVGKV RV DD  
Sbjct: 89  FLMLVPYILIFAVFWFFLIRPQQVRAKEHRAKIAAVKPRDQVVTGGGIVGKVTRV-DDDY 147

Query: 81  LEVEIAENVRVRVVRSFVSEVQ-SKSEP 107
            +VEIA+ V+V+VV++ +++V     +P
Sbjct: 148 ADVEIAQGVKVKVVKATLADVLQPGGKP 175


>gi|307543990|ref|YP_003896469.1| preprotein translocase subunit YajC [Halomonas elongata DSM 2581]
 gi|307216014|emb|CBV41284.1| K03210 preprotein translocase YajC subunit [Halomonas elongata DSM
           2581]
          Length = 112

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 54/106 (50%), Gaps = 4/106 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   AQ       +    +    +     +++YFLL RPQ ++ ++  +++  L +GD 
Sbjct: 6   ISPALAQDA---GGAPGGGIAQIVMLVGFVLIFYFLLWRPQAKRAKQHKKLISGLSKGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
           IV   G++G++ +V +D E L +EIAE   V V ++ V+ V  K  
Sbjct: 63  IVIGGGMLGRITKVSEDSEFLTMEIAEGTEVNVQKNAVATVLPKGT 108


>gi|326319354|ref|YP_004237026.1| preprotein translocase subunit YajC [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323376190|gb|ADX48459.1| preprotein translocase, YajC subunit [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 110

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 34/92 (36%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               S L       ++ VV YF++IRPQ ++ +    M+  + +GD + TA GI+GKV R
Sbjct: 18  GGMMSSLTSMLPLVLMFVVLYFIMIRPQMKRQKEHRAMIDAIAKGDEVATAGGILGKVTR 77

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +   L +EIA  V V+V RS VS+V  K  
Sbjct: 78  LSEGF-LHIEIASGVEVQVQRSSVSQVLPKGT 108


>gi|16126235|ref|NP_420799.1| preprotein translocase, YajC subunit [Caulobacter crescentus CB15]
 gi|221235008|ref|YP_002517444.1| protein translocase subunit YajC [Caulobacter crescentus NA1000]
 gi|13423461|gb|AAK23967.1| preprotein translocase, YajC subunit [Caulobacter crescentus CB15]
 gi|220964180|gb|ACL95536.1| protein translocase subunit YajC [Caulobacter crescentus NA1000]
          Length = 103

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
              S  + L       ++ V++YF+LIRPQ+++ +    ML NL+R D++V ++G++GK+
Sbjct: 2   PTGSTAATLMNILPIILMVVLFYFMLIRPQQKRQKEHLNMLNNLKRNDTVVLSSGMIGKI 61

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           VRV +D E+ VEIA  V V+VV+  ++EV++K EP
Sbjct: 62  VRV-EDREVGVEIATGVTVKVVKGMIAEVRTKGEP 95


>gi|15613792|ref|NP_242095.1| hypothetical protein BH1229 [Bacillus halodurans C-125]
 gi|13634066|sp|Q9KDI4|Y1229_BACHD RecName: Full=UPF0092 membrane protein BH1229
 gi|10173845|dbj|BAB04948.1| BH1229 [Bacillus halodurans C-125]
          Length = 88

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
                     ++  ++YFLLIRPQ+++ ++  EM  NL+RGD IVT  G+ G +  + D+
Sbjct: 3   GLGGFLIPLILMFAIFYFLLIRPQQKRQKQIQEMHNNLQRGDKIVTIGGLHGTIDSL-DE 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQS 103
             + + + +N ++   RS + EV +
Sbjct: 62  STVVILVNDNRKLTFDRSAIREVVN 86


>gi|58040230|ref|YP_192194.1| protein translocase subunit YajC [Gluconobacter oxydans 621H]
 gi|58002644|gb|AAW61538.1| Protein translocase subunit YajC [Gluconobacter oxydans 621H]
          Length = 128

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 62/102 (60%), Gaps = 1/102 (0%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           AQ+       +   +        + VV+YFLLIRPQ+Q+ ++  +   +LRRGD IVTA 
Sbjct: 23  AQAADGGGLLSNPQVLQFAPMIFIFVVFYFLLIRPQQQRARKLRDEQGSLRRGDRIVTAG 82

Query: 67  GIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           GIVG V    DD  E++VEIA+ VRV++VRS ++ +  + +P
Sbjct: 83  GIVGVVQATRDDSDEVDVEIAQGVRVKIVRSTITNIMPRDKP 124


>gi|293607155|ref|ZP_06689497.1| preprotein translocase [Achromobacter piechaudii ATCC 43553]
 gi|292814489|gb|EFF73628.1| preprotein translocase [Achromobacter piechaudii ATCC 43553]
          Length = 114

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 9/108 (8%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           + V AQ+ AP      + L       ++ V+ YFL+IRPQ ++ +    ++  L +GD +
Sbjct: 8   SLVVAQAAAPE----GNALMGMLPIVLMFVILYFLMIRPQMKRQKEHRNLIAALAKGDEV 63

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAE----NVRVRVVRSFVSEVQSKSE 106
           VTA G++GKV +V +D  + VE++E     V V + +S VS V  K  
Sbjct: 64  VTAGGMLGKVTKV-NDSYVTVEVSELADKPVEVIMQKSSVSTVLPKGT 110


>gi|332977835|gb|EGK14590.1| preprotein translocase [Desmospora sp. 8437]
          Length = 102

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++  V+YFLLIRPQ++  + R  ML  L++GD I+T  G+ G +  + +
Sbjct: 1   MQGLGQFLPLILIIAVFYFLLIRPQQKHKKERNAMLSALKKGDKIITIGGLHGTITDLTE 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + +++++N R+   RS V+ V +  +
Sbjct: 61  D-RVTLKVSDNSRLVFERSAVNTVVNADD 88


>gi|222112519|ref|YP_002554783.1| preprotein translocase subunit YajC [Acidovorax ebreus TPSY]
 gi|221731963|gb|ACM34783.1| preprotein translocase, YajC subunit [Acidovorax ebreus TPSY]
          Length = 110

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA G++GKV  +
Sbjct: 19  GLMGSLTSMLPLVLMFVVLYFIMIRPQMKRQKEHRAMIDALAKGDEVATAGGLLGKVAGL 78

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +   L++EIA  V+V+V RS V++V  K  
Sbjct: 79  SEG-YLQLEIAPGVQVQVQRSAVAQVLPKGT 108


>gi|190573979|ref|YP_001971824.1| preprotein translocase subunit YajC [Stenotrophomonas maltophilia
           K279a]
 gi|190011901|emb|CAQ45522.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
          Length = 114

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                L       +L  + YFL+IRPQ ++ +    ML  ++RGD ++T  GI G V  +
Sbjct: 20  PQGMGLTTLLFPVILIAIMYFLMIRPQMKRQKEHKAMLEKIKRGDEVLTNGGIAGIVTDI 79

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D  + +E+A+NVR+RV +  V  V     
Sbjct: 80  -GDNFITIEVADNVRIRVQKGAVGNVLPAGT 109


>gi|71892011|ref|YP_277741.1| preprotein translocase, auxillary membrane component [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
 gi|71796117|gb|AAZ40868.1| preprotein translocase, auxillary membrane component [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
          Length = 115

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 54/105 (51%), Gaps = 5/105 (4%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A   +    S  +P  +  +  V A ++YF++ RPQ+++ +   E+L ++ +GD I+T  
Sbjct: 7   AAWASVNANSQGNPYSLVIMLTVFAGIFYFMIFRPQQKRNKIHKELLSSISKGDEILTNG 66

Query: 67  GIVGKVVRVIDDLELEVEIAE-----NVRVRVVRSFVSEVQSKSE 106
           G+VG+VV+V +   + V + +        + + R  ++ +  K  
Sbjct: 67  GLVGRVVKVTETGYIFVILNDKNDTNGNEILIKRDCITAILPKGT 111


>gi|254522549|ref|ZP_05134604.1| preprotein translocase, YajC subunit [Stenotrophomonas sp. SKA14]
 gi|219720140|gb|EED38665.1| preprotein translocase, YajC subunit [Stenotrophomonas sp. SKA14]
          Length = 114

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                L       +L  + YFL+IRPQ ++ +    ML  ++RGD ++T  GI G V  +
Sbjct: 20  PQGMGLTTLLFPIILIAIMYFLMIRPQMKRQKEHKAMLEKIKRGDEVLTNGGIAGIVTDI 79

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D  + +E+A+NVR+RV +  V  V     
Sbjct: 80  -GDNFITIEVADNVRIRVQKGAVGNVLPAGT 109


>gi|288549982|ref|ZP_05968859.2| preprotein translocase, YajC subunit [Enterobacter cancerogenus
           ATCC 35316]
 gi|288316865|gb|EFC55803.1| preprotein translocase, YajC subunit [Enterobacter cancerogenus
           ATCC 35316]
          Length = 90

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 50/86 (58%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           + +  +  V  +++YF+++RPQ+++ +    ++ ++ +GD ++T  G+VG+V +V +   
Sbjct: 1   MSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMNSIAKGDEVLTNGGLVGRVTKVAESGY 60

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + + + +   V + R FV+ V  K  
Sbjct: 61  IAIALNDTTEVVIKRDFVAAVLPKGT 86


>gi|254429246|ref|ZP_05042953.1| preprotein translocase, YajC subunit [Alcanivorax sp. DG881]
 gi|196195415|gb|EDX90374.1| preprotein translocase, YajC subunit [Alcanivorax sp. DG881]
          Length = 116

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +  V+ VV+YF LIRPQ+++ +    ++++L +GD +VT+ GI+GKV +V DD  + V
Sbjct: 31  LIMLVVMMVVFYFFLIRPQQKRAKEHKNLVQSLSKGDEVVTSGGILGKVAKVTDDF-VVV 89

Query: 84  EIAENVRVRVVRSFVSEVQSKSE 106
           EI+ N+ +++ +S V     K  
Sbjct: 90  EISNNLEIKLQKSSVQATLPKGT 112


>gi|121596290|ref|YP_988186.1| protein translocase subunit yajC [Acidovorax sp. JS42]
 gi|120608370|gb|ABM44110.1| protein translocase subunit yajC [Acidovorax sp. JS42]
          Length = 109

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA G++GKV  +
Sbjct: 18  GLMGSLTSMLPLVLMFVVLYFIMIRPQMKRQKEHRAMIDALAKGDEVATAGGLLGKVAGL 77

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +   L++EIA  V+V+V RS V++V  K  
Sbjct: 78  SEG-YLQLEIAPGVQVQVQRSAVAQVLPKGT 107


>gi|310815838|ref|YP_003963802.1| preprotein translocase, YajC subunit [Ketogulonicigenium vulgare
           Y25]
 gi|308754573|gb|ADO42502.1| preprotein translocase, YajC subunit [Ketogulonicigenium vulgare
           Y25]
          Length = 94

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 1/91 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              LE      ++ V+ Y LLIRPQ+++L++  EML+ LRRGD IVT  G++GKV +V +
Sbjct: 1   MQGLEAFIPMILIFVIMYLLLIRPQQKKLKQHQEMLKALRRGDQIVTQGGVIGKVAKVKE 60

Query: 78  D-LELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +  E+EVEIAE V VRV+RS +S+V +K+EP
Sbjct: 61  ETNEVEVEIAEGVTVRVMRSTISQVLNKTEP 91


>gi|68248849|ref|YP_247961.1| preprotein translocase subunit YajC [Haemophilus influenzae
           86-028NP]
 gi|145631085|ref|ZP_01786860.1| preprotein translocase subunit YajC [Haemophilus influenzae R3021]
 gi|145632485|ref|ZP_01788219.1| preprotein translocase subunit YajC [Haemophilus influenzae 3655]
 gi|145635147|ref|ZP_01790852.1| preprotein translocase subunit YajC [Haemophilus influenzae PittAA]
 gi|145637217|ref|ZP_01792879.1| preprotein translocase subunit YajC [Haemophilus influenzae PittHH]
 gi|145640164|ref|ZP_01795748.1| preprotein translocase subunit YajC [Haemophilus influenzae R3021]
 gi|148825477|ref|YP_001290230.1| preprotein translocase subunit YajC [Haemophilus influenzae PittEE]
 gi|148827380|ref|YP_001292133.1| preprotein translocase subunit YajC [Haemophilus influenzae PittGG]
 gi|229844944|ref|ZP_04465081.1| preprotein translocase subunit YajC [Haemophilus influenzae 6P18H1]
 gi|229846329|ref|ZP_04466437.1| preprotein translocase subunit YajC [Haemophilus influenzae 7P49H1]
 gi|260582874|ref|ZP_05850659.1| preprotein translocase, YajC subunit [Haemophilus influenzae NT127]
 gi|319775888|ref|YP_004138376.1| preprotein translocase subunit YajC [Haemophilus influenzae F3047]
 gi|319896576|ref|YP_004134769.1| preprotein translocase subunit yajc [Haemophilus influenzae F3031]
 gi|329123737|ref|ZP_08252297.1| preprotein translocase [Haemophilus aegyptius ATCC 11116]
 gi|68057048|gb|AAX87301.1| conserved hypothetical preprotein translocase subunit YajC
           [Haemophilus influenzae 86-028NP]
 gi|144983370|gb|EDJ90852.1| preprotein translocase subunit YajC [Haemophilus influenzae R3021]
 gi|144986680|gb|EDJ93232.1| preprotein translocase subunit YajC [Haemophilus influenzae 3655]
 gi|145267568|gb|EDK07567.1| preprotein translocase subunit YajC [Haemophilus influenzae PittAA]
 gi|145269662|gb|EDK09603.1| preprotein translocase subunit YajC [Haemophilus influenzae PittHH]
 gi|145274750|gb|EDK14612.1| preprotein translocase subunit YajC [Haemophilus influenzae
           22.4-21]
 gi|148715637|gb|ABQ97847.1| preprotein translocase subunit YajC [Haemophilus influenzae PittEE]
 gi|148718622|gb|ABQ99749.1| preprotein translocase subunit YajC [Haemophilus influenzae PittGG]
 gi|229810422|gb|EEP46140.1| preprotein translocase subunit YajC [Haemophilus influenzae 7P49H1]
 gi|229812078|gb|EEP47770.1| preprotein translocase subunit YajC [Haemophilus influenzae 6P18H1]
 gi|260094087|gb|EEW77990.1| preprotein translocase, YajC subunit [Haemophilus influenzae NT127]
 gi|301168889|emb|CBW28483.1| SecYEG protein translocase auxillary subunit [Haemophilus
           influenzae 10810]
 gi|309972614|gb|ADO95815.1| General secretory pathway component YajC [Haemophilus influenzae
           R2846]
 gi|317432078|emb|CBY80428.1| conserved hypothetical preprotein translocase subunit YajC
           [Haemophilus influenzae F3031]
 gi|317450479|emb|CBY86696.1| conserved hypothetical preprotein translocase subunit YajC
           [Haemophilus influenzae F3047]
 gi|327469936|gb|EGF15401.1| preprotein translocase [Haemophilus aegyptius ATCC 11116]
          Length = 97

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           A SP+    +F +  +++YF++ RPQ ++ +   +++  L +G  ++TA G++GK+ +V 
Sbjct: 3   AQSPMSTLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLTAGGLIGKITKVT 62

Query: 77  DD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
           +    + + + +   + + R+++  V  K 
Sbjct: 63  EGSDSIVIALNDTTEITINRNYIVSVLPKG 92


>gi|319764884|ref|YP_004128821.1| preprotein translocase, yajc subunit [Alicycliphilus denitrificans
           BC]
 gi|330827089|ref|YP_004390392.1| preprotein translocase subunit YajC [Alicycliphilus denitrificans
           K601]
 gi|317119445|gb|ADV01934.1| preprotein translocase, YajC subunit [Alicycliphilus denitrificans
           BC]
 gi|329312461|gb|AEB86876.1| preprotein translocase, YajC subunit [Alicycliphilus denitrificans
           K601]
          Length = 110

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/92 (33%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                 L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA G++GKV  
Sbjct: 18  GGLMGSLTGMLPLVLMFVVLYFIMIRPQMKRQKEHRAMIDALAKGDEVATAGGLLGKVAG 77

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +   +++EIA  V+V+V RS VS+V  K  
Sbjct: 78  LSEG-YIQLEIASGVQVQVQRSAVSQVLPKGT 108


>gi|291288353|ref|YP_003505169.1| preprotein translocase, YajC subunit [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885513|gb|ADD69213.1| preprotein translocase, YajC subunit [Denitrovibrio acetiphilus DSM
           12809]
          Length = 110

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 54/90 (60%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             SPL       ++  ++YFLLIRPQ+++ ++   ML ++  GD I+T  G+ GKV++VI
Sbjct: 15  QGSPLAPFIPLILIFAIFYFLLIRPQQKKQKQHVAMLNSITAGDEIMTGGGMYGKVLKVI 74

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++    VEIA  V +++ ++ +++  +   
Sbjct: 75  ENNTFIVEIASGVTIKLAKNGIAQKVTPGT 104


>gi|253997302|ref|YP_003049366.1| preprotein translocase subunit YajC [Methylotenera mobilis JLW8]
 gi|253983981|gb|ACT48839.1| preprotein translocase, YajC subunit [Methylotenera mobilis JLW8]
          Length = 104

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 7/105 (6%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA +                   V+ ++++F++IRPQ +Q + +  M+  L++GD 
Sbjct: 3   ISNAYAATAPATD------FTSFLPLIVIFLLFFFMIIRPQMKQAKEQRNMIAALQKGDE 56

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  GIVGKV +V D   + +EIA N  + V +  +     K  
Sbjct: 57  VVTTGGIVGKVTKVTDAF-VTLEIATNTEINVQKHAIQSALPKGT 100


>gi|310643554|ref|YP_003948312.1| preprotein translocase, yajc subunit [Paenibacillus polymyxa SC2]
 gi|309248504|gb|ADO58071.1| Preprotein translocase, YajC subunit [Paenibacillus polymyxa SC2]
          Length = 111

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
             +M     ++ V++YFLLIRP +++ ++R  ML+ L++GD ++T  G+ G +V + DD 
Sbjct: 17  LFQMIWPLALMFVIFYFLLIRPNQKKQKQRQSMLQALKKGDKVITIGGLHGTIVEITDD- 75

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + + + +  ++   RS +S   +K  
Sbjct: 76  VVVLRVNDVTKLTFDRSAISNAIAKDT 102


>gi|33592188|ref|NP_879832.1| putative secreted protein [Bordetella pertussis Tohama I]
 gi|33595819|ref|NP_883462.1| putative secreted protein [Bordetella parapertussis 12822]
 gi|33600347|ref|NP_887907.1| putative secreted protein [Bordetella bronchiseptica RB50]
 gi|33565898|emb|CAE36446.1| putative secreted protein [Bordetella parapertussis]
 gi|33567946|emb|CAE31859.1| putative secreted protein [Bordetella bronchiseptica RB50]
 gi|33571833|emb|CAE41346.1| putative secreted protein [Bordetella pertussis Tohama I]
 gi|332381605|gb|AEE66452.1| putative secreted protein [Bordetella pertussis CS]
          Length = 114

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 5/100 (5%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A A  +  + L       ++ V+ YFL+IRPQ ++ +    M+  L +GD +VT+ G++G
Sbjct: 12  AQAAPAEGNALMGMLPIVLMFVILYFLMIRPQMKRQKEHRNMVAALSKGDEVVTSGGMLG 71

Query: 71  KVVRVIDDLELEVEIAE----NVRVRVVRSFVSEVQSKSE 106
           +V +V  D  + VE++E     V V + ++ VS V  K  
Sbjct: 72  RVSKVT-DSYITVEVSELADKPVEVVMQKTAVSAVLPKGT 110


>gi|15616754|ref|NP_239966.1| hypothetical protein BU134 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681509|ref|YP_002467894.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|219682065|ref|YP_002468449.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|257471190|ref|ZP_05635189.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. LSR1 (Acyrthosiphon pisum)]
 gi|11387271|sp|P57234|Y134_BUCAI RecName: Full=UPF0092 membrane protein BU134
 gi|25302581|pir||D84945 hypothetical protein yajC [imported] - Buchnera sp. (strain APS)
 gi|10038817|dbj|BAB12852.1| hypothetical protein [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|219621798|gb|ACL29954.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|219624352|gb|ACL30507.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|311085878|gb|ADP65960.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. LL01 (Acyrthosiphon pisum)]
 gi|311086448|gb|ADP66529.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. TLW03 (Acyrthosiphon pisum)]
 gi|311087030|gb|ADP67110.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. JF99 (Acyrthosiphon pisum)]
 gi|311087595|gb|ADP67674.1| subunit of SecD-SecF-Yajc-YidC secretion complex [Buchnera
           aphidicola str. JF98 (Acyrthosiphon pisum)]
          Length = 111

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 56/105 (53%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           F    A +     + +++   +  +  +  +++YF+L RPQ+++ +    ++ +L +GD 
Sbjct: 3   FFIQNANAVVNGTSESSNSYSLIFMAVIFLLIFYFMLFRPQQKKDKEHKNLINSLVQGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T +G++G++ ++  +  + +E+ E   V + + F+  +  K  
Sbjct: 63  VITTSGLLGRIKKITKNGYILLELNETTEVFIKQDFIVSLLPKGT 107


>gi|323137258|ref|ZP_08072337.1| preprotein translocase, YajC subunit [Methylocystis sp. ATCC 49242]
 gi|322397616|gb|EFY00139.1| preprotein translocase, YajC subunit [Methylocystis sp. ATCC 49242]
          Length = 172

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/101 (44%), Positives = 66/101 (65%)

Query: 8   QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAG 67
           Q D     S    +      FV+  + Y L+IRP+ ++ + +   LRN+RRGD+IVT  G
Sbjct: 41  QPDPNQPPSLPDLMAQLIPIFVVMGIVYILVIRPRARREKEQLAALRNVRRGDTIVTTGG 100

Query: 68  IVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V KV R IDD E+EVEI+ NVRVR++R+ ++EV++K EPV
Sbjct: 101 VVCKVTRAIDDAEVEVEISPNVRVRLLRTAIAEVRAKGEPV 141


>gi|259502860|ref|ZP_05745762.1| preprotein translocase [Lactobacillus antri DSM 16041]
 gi|259169227|gb|EEW53722.1| preprotein translocase [Lactobacillus antri DSM 16041]
          Length = 148

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 43/92 (46%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             + T       L  ++  + YF +IRPQ++Q ++  EM+  L +GD +VT   + GK+ 
Sbjct: 12  AAANTGGYSSIILIVLMIALMYFFMIRPQQKQRKQHQEMMNELHKGDEVVTIGRLHGKID 71

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            V  D +      E + +      ++ V  ++
Sbjct: 72  EVNKDNQTVTLDCEGIYLTFDMVAIARVLKRA 103


>gi|254361840|ref|ZP_04977975.1| preprotein translocase subunit YajC [Mannheimia haemolytica PHL213]
 gi|261491628|ref|ZP_05988211.1| preprotein translocase subunit YajC [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261494988|ref|ZP_05991457.1| preprotein translocase subunit YajC [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|153093375|gb|EDN74371.1| preprotein translocase subunit YajC [Mannheimia haemolytica PHL213]
 gi|261309397|gb|EEY10631.1| preprotein translocase subunit YajC [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312754|gb|EEY13874.1| preprotein translocase subunit YajC [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 97

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                +EM  +  +   ++YF++ RPQ ++ +++ ++L +L +GD ++T+ G++GK+ +V
Sbjct: 2   QQGGGMEMIFILIIFGAIFYFMIYRPQAKRQKQQRDLLASLTKGDEVLTSGGLIGKITKV 61

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
             D+  + + + +   V + R FV  V  K 
Sbjct: 62  TADNDNIVIALNDTTEVTIKRDFVVAVLPKG 92


>gi|239809479|gb|ACS26205.1| unknown [uncultured bacterium]
          Length = 109

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                           V++Y ++ RPQ ++ +    ++  L++GD +VT+ GI GKV +V
Sbjct: 16  GPAGTGFEWVFLVGFLVIFYLMIWRPQSKRAKEHKNLIAGLQKGDEVVTSGGIAGKVTKV 75

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            DD  + +E+++NV ++  +  ++    K  
Sbjct: 76  ADDF-VVIEVSDNVELKFQKVAIAATLPKGT 105


>gi|285018697|ref|YP_003376408.1| preprotein translocase, yajc subunit [Xanthomonas albilineans GPE
           PC73]
 gi|283473915|emb|CBA16416.1| putative preprotein translocase, yajc subunit [Xanthomonas
           albilineans]
          Length = 114

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +     AQ+     + A   L+M  L  +L  V YF +IRPQ ++ +    ML  L RGD
Sbjct: 7   LIPVAQAQTAGGTAS-AGGGLQMFLLPVILIAVMYFAMIRPQMKKQKEHKSMLDKLGRGD 65

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+ G V  +  D  + VE+AENVR+RV +  +  V  K  
Sbjct: 66  EVITSGGVAGVVTDI-GDNFITVEVAENVRIRVQKGAIGNVLPKGT 110


>gi|167855991|ref|ZP_02478737.1| preprotein translocase subunit YajC [Haemophilus parasuis 29755]
 gi|219871166|ref|YP_002475541.1| preprotein translocase subunit YajC [Haemophilus parasuis SH0165]
 gi|167852873|gb|EDS24141.1| preprotein translocase subunit YajC [Haemophilus parasuis 29755]
 gi|219691370|gb|ACL32593.1| preprotein translocase subunit YajC [Haemophilus parasuis SH0165]
          Length = 97

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                +EM  +  V  +++YF++ RPQ ++ +++ E+L  L +GD ++T+ G++GK+ +V
Sbjct: 2   QQGGGMEMIFILVVFGLIFYFMIYRPQAKRQKQQRELLAGLSKGDEVLTSGGLIGKITKV 61

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
             D+  + + + +   V + R FV  V  K 
Sbjct: 62  TADNDNVVIALNDTTEVTIKRDFVVAVLPKG 92


>gi|118602969|ref|YP_904184.1| protein translocase subunit yajC [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
 gi|118567908|gb|ABL02713.1| protein translocase subunit yajC [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
          Length = 113

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 60/105 (57%), Gaps = 2/105 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +   V+A+  + +  S + P        V+ V+ YFLLIRPQ+++ +    +L  L++GD
Sbjct: 7   IIAPVFAE-GSVSEGSISDPWGGLPFLLVMFVLMYFLLIRPQQKRAKEHKTLLLTLKKGD 65

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +VT  G++GKV+ V +   + +EIA+ + V++ +  +++   K 
Sbjct: 66  EVVTNGGVIGKVISVDESFAI-LEIADGIVVKLQKQGINQKMPKG 109


>gi|308070375|ref|YP_003871980.1| preprotein translocase, YajC subunit [Paenibacillus polymyxa E681]
 gi|305859654|gb|ADM71442.1| preprotein translocase, YajC subunit [Paenibacillus polymyxa E681]
          Length = 111

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
             +M     ++ V++YFLLIRP +++ ++R  ML+ L++GD ++T  G+ G +V + DD 
Sbjct: 17  LFQMIWPLALMFVIFYFLLIRPNQKKQKQRQTMLQALKKGDKVITIGGLHGTIVEITDD- 75

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + + + +  ++   RS +S   +K  
Sbjct: 76  VVVLRVNDVTKLTFDRSAISNAIAKDT 102


>gi|149177811|ref|ZP_01856410.1| YajC [Planctomyces maris DSM 8797]
 gi|148843301|gb|EDL57665.1| YajC [Planctomyces maris DSM 8797]
          Length = 117

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 58/106 (54%), Gaps = 4/106 (3%)

Query: 5   VYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVT 64
           ++AQ        A SP+        + + +YF++ RPQ+++  +R   L  L++ D +VT
Sbjct: 10  LFAQDAPVKEGPAPSPILQFLPLIAIVIFFYFIMFRPQQKERAKREAALGQLKKNDRVVT 69

Query: 65  AAGIVGKVVRVID-DLELEVEIAENVRVRVVRSFVS---EVQSKSE 106
             GI+G +  + + + E+ ++I +N +++V RS +    +V++K  
Sbjct: 70  IGGIIGTIANIAENEQEVTLKIDDNAKIKVRRSAIQGPYQVETKET 115


>gi|170723505|ref|YP_001751193.1| preprotein translocase subunit YajC [Pseudomonas putida W619]
 gi|325272156|ref|ZP_08138587.1| preprotein translocase subunit YajC [Pseudomonas sp. TJI-51]
 gi|169761508|gb|ACA74824.1| preprotein translocase, YajC subunit [Pseudomonas putida W619]
 gi|324102719|gb|EGC00135.1| preprotein translocase subunit YajC [Pseudomonas sp. TJI-51]
          Length = 111

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L NL++GD +VT  GI GK+V+V DD  + +E
Sbjct: 27  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLSNLQKGDEVVTNGGIAGKIVKVSDDF-VVLE 85

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V ++  +  ++    K  
Sbjct: 86  VSDTVELKFQKGAIAATLPKGT 107


>gi|33152764|ref|NP_874117.1| preprotein translocase subunit YajC [Haemophilus ducreyi 35000HP]
 gi|33148988|gb|AAP96506.1| Conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 98

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S LEM  +  +  +++YF++ RPQ ++ +++ ++L +L +GD ++T  G++G++ +V
Sbjct: 2   QQGSGLEMIFILAIFGLIFYFMIYRPQAKRQKQQRDLLASLAKGDEVLTNGGLIGRITKV 61

Query: 76  IDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
             D E + + + +   V + R+++  V  K +
Sbjct: 62  NSDSENVVIALNDTTEVVISRNYIVAVLPKGQ 93


>gi|330993358|ref|ZP_08317293.1| Immunogenic membrane protein yajC [Gluconacetobacter sp. SXCC-1]
 gi|329759388|gb|EGG75897.1| Immunogenic membrane protein yajC [Gluconacetobacter sp. SXCC-1]
          Length = 129

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/104 (36%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           T  +AQ+    + S    +     +  +  ++YFLLIRPQ+ + ++    L  LRRGD +
Sbjct: 11  TPAHAQAAGGGLLSGDG-IMAVLPYVAMFAIFYFLLIRPQQVKQKQLRSQLAALRRGDRV 69

Query: 63  VTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +TA GI+G V +V  +  E+EVEIA+ VRV V+R  +S V + +
Sbjct: 70  LTAGGIIGVVQKVQAESNEVEVEIAQGVRVAVLRDTISSVITSA 113


>gi|330504698|ref|YP_004381567.1| preprotein translocase subunit YajC [Pseudomonas mendocina NK-01]
 gi|328918984|gb|AEB59815.1| preprotein translocase subunit YajC [Pseudomonas mendocina NK-01]
          Length = 109

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 2/92 (2%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
             A S  E         V++Y ++ RPQ ++ +    +L  L++GD +VT+ GI GKV +
Sbjct: 16  GPAGSGFE-WVFLIGFLVIFYLMIWRPQAKRAKEHKNLLGGLQKGDEVVTSGGIAGKVSK 74

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           V DD  + +E+++ V ++  +  ++    K  
Sbjct: 75  VTDDF-VVIEVSDTVELKFQKQAIAATLPKGT 105


>gi|258647541|ref|ZP_05735010.1| preprotein translocase, YajC subunit [Prevotella tannerae ATCC
           51259]
 gi|260852325|gb|EEX72194.1| preprotein translocase, YajC subunit [Prevotella tannerae ATCC
           51259]
          Length = 100

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
            A       ++M  +   L  + YF +IRPQ ++ +   +    L  G  ++T  GI G 
Sbjct: 7   AAAQPQGGGIQMIVMLVGLFAIVYFFMIRPQNKKQKEIQKFRNALEVGQDVITIGGIHGT 66

Query: 72  VVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           + R+ D+  + + ++  V ++  RS +     K +P
Sbjct: 67  IKRIEDNDIITLSVSTGVEIKFDRSAI---MPKGQP 99


>gi|26987570|ref|NP_742995.1| preprotein translocase subunit YajC [Pseudomonas putida KT2440]
 gi|148546108|ref|YP_001266210.1| preprotein translocase subunit YajC [Pseudomonas putida F1]
 gi|167031892|ref|YP_001667123.1| preprotein translocase subunit YajC [Pseudomonas putida GB-1]
 gi|24982245|gb|AAN66459.1|AE016275_4 preprotein translocase, YajC subunit [Pseudomonas putida KT2440]
 gi|148510166|gb|ABQ77026.1| protein translocase subunit yajC [Pseudomonas putida F1]
 gi|166858380|gb|ABY96787.1| preprotein translocase, YajC subunit [Pseudomonas putida GB-1]
 gi|313497203|gb|ADR58569.1| YajC [Pseudomonas putida BIRD-1]
          Length = 111

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L NL++GD +VT  GI GK+V+V DD  + +E
Sbjct: 27  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLSNLQKGDEVVTNGGIAGKIVKVSDDF-VVLE 85

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V ++  +  ++    K  
Sbjct: 86  VSDTVELKFQKGAIAATLPKGT 107


>gi|114771850|ref|ZP_01449243.1| preprotein translocase, YajC subunit [alpha proteobacterium
           HTCC2255]
 gi|114547666|gb|EAU50557.1| preprotein translocase, YajC subunit [alpha proteobacterium
           HTCC2255]
          Length = 107

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 60/83 (72%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
               ++  + YFL+IRPQ++++++   M+  +R+GD IVTA G++GKV +V  D E+EVE
Sbjct: 23  MPLILIFGIMYFLMIRPQQKKVKQHQAMVAAVRKGDQIVTAGGLIGKVTKVNTDNEVEVE 82

Query: 85  IAENVRVRVVRSFVSEVQSKSEP 107
           I+  V+V+VV+  +S+V +K+EP
Sbjct: 83  ISSGVKVKVVQHTISQVLNKTEP 105


>gi|332992256|gb|AEF02311.1| preprotein translocase subunit YajC [Alteromonas sp. SN2]
          Length = 112

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
           +EM  +  V  +++YFLL RPQ ++++    ++ +L +GD ++T  GIVG++ +V DD  
Sbjct: 22  MEMIIMLAVFGLIFYFLLYRPQAKRVKEHKNLVTSLGKGDEVLTQGGIVGRITKVSDDKD 81

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +E+ + +   + V +S V+ V  K  
Sbjct: 82  FIEISLNDTNNIVVQKSSVTAVLPKGT 108


>gi|229586923|ref|YP_002845424.1| preprotein translocase subunit YajC [Rickettsia africae ESF-5]
 gi|228021973|gb|ACP53681.1| Preprotein translocase YajC subunit [Rickettsia africae ESF-5]
          Length = 204

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+YFLL+RPQ  + + R +++  +++G+ ++T +GI G V 
Sbjct: 91  TNSLQSGLTSLIPMVLIFAVFYFLLLRPQETRRKEREKLVSEVKKGEEVLTNSGIYGIVT 150

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V + D  +E+EIA++VR++V++S + ++ S+++ V
Sbjct: 151 KVSENDNNIEIEIAKDVRIKVLKSAIIDITSRTKEV 186


>gi|312878166|ref|ZP_07738096.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795056|gb|EFR11455.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 121

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 6/113 (5%)

Query: 1   MFTTVYA------QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLR 54
           +F   YA      Q  APA  +A + L       ++ VV Y L+I PQR++ ++  EM+ 
Sbjct: 7   LFEIAYATGNQSSQQQAPAGATAIALLAQFIPLILMFVVLYLLIIVPQRRREKQFREMIN 66

Query: 55  NLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +L  GD IVT AGI+GK+V + DD+      A+ V++++ +  V EV  K+EP
Sbjct: 67  SLIVGDEIVTNAGIIGKIVNIKDDILTIEVGADRVKLKIYKWAVKEVLKKAEP 119


>gi|91792760|ref|YP_562411.1| preprotein translocase subunit YajC [Shewanella denitrificans
           OS217]
 gi|91714762|gb|ABE54688.1| protein translocase subunit yajC [Shewanella denitrificans OS217]
          Length = 91

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 53/86 (61%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
           +EM  +  +  +++YF++ RPQ ++++    ++ +L +GD ++T+ GI+GK+ ++ DD  
Sbjct: 1   MEMIFMLAIFGLIFYFMIFRPQSKRVKEHKNLMSSLGKGDEVLTSGGILGKIAKINDDSD 60

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKS 105
            + + I E  ++ + + +++ V  K 
Sbjct: 61  YVLLSINETAQITIKKDYITAVLPKG 86


>gi|108757243|ref|YP_632858.1| preprotein translocase subunit YajC [Myxococcus xanthus DK 1622]
 gi|108461123|gb|ABF86308.1| preprotein translocase, YajC subunit [Myxococcus xanthus DK 1622]
          Length = 118

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 57/88 (64%), Gaps = 1/88 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A     +PL   G   +L  + YF++IRPQ++QL+    +L  L++GD +VT+ GI+GK+
Sbjct: 9   AQAGGGNPLGTLGFLVILVGIMYFVMIRPQQKQLKEHRALLSALKKGDEVVTSGGILGKI 68

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSE 100
             ++D+  + +E++  VR+RV+++ VS 
Sbjct: 69  -HLVDERTVTLEVSSGVRIRVLKTAVSA 95


>gi|332141986|ref|YP_004427724.1| preprotein translocase subunit YajC [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327552008|gb|AEA98726.1| preprotein translocase subunit YajC [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 112

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
           +EM  +  V  +++YFLL RPQ ++++    ++ +L +GD ++T  G+VGK+ +V ++  
Sbjct: 22  MEMIIMLAVFGLIFYFLLYRPQAKRVKEHKNLVSSLGKGDEVLTQGGLVGKITKVSEEKD 81

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +EV + ++  + V +S V+ V  K  
Sbjct: 82  FIEVALNDSNNIVVQKSSVTAVLPKGT 108


>gi|119775327|ref|YP_928067.1| preprotein translocase subunit YajC [Shewanella amazonensis SB2B]
 gi|119767827|gb|ABM00398.1| protein translocase subunit yajC [Shewanella amazonensis SB2B]
          Length = 111

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 59/106 (55%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF +    + A A       +E+  +  +  +++YF++ RPQ ++++    ++ +L +GD
Sbjct: 1   MFISNAYANAAGAAPQGGGTMELVIMLGLFGLIFYFMIFRPQSKRVKEHKALMSSLSKGD 60

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
            ++T+ GI+GK+ ++ +D   + + + ++  + + + +++ V  K 
Sbjct: 61  EVLTSGGILGKIAKITEDSDYVLLALNDSTNITIKKDYIAAVLPKG 106


>gi|170718436|ref|YP_001783654.1| preprotein translocase subunit YajC [Haemophilus somnus 2336]
 gi|168826565|gb|ACA31936.1| preprotein translocase, YajC subunit [Haemophilus somnus 2336]
          Length = 99

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
              +SPL M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++T+ GI+GK+ +
Sbjct: 3   AQQSSPLSMLFIFAIFGLIFYFMIYRPQAKRNKAHKQLMSELAKGTEVLTSGGIIGKISK 62

Query: 75  VI-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +  ++  + + + +   + + R F+  V  K 
Sbjct: 63  ISAENDYVVIALNDTTEITIKRDFIVAVLPKG 94


>gi|327481772|gb|AEA85082.1| preprotein translocase subunit YajC [Pseudomonas stutzeri DSM 4166]
          Length = 109

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                           V++Y ++ RPQ ++ +    ++  L++GD +VT+ GI GKV +V
Sbjct: 16  GPAGTGFEWVFLVGFLVIFYLMIWRPQAKRAKEHKNLIAGLQKGDEVVTSGGIAGKVTKV 75

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            DD  + +E+++NV ++  +  ++    K  
Sbjct: 76  ADDF-VVIEVSDNVELKFQKVAIAATLPKGT 105


>gi|312884251|ref|ZP_07743960.1| preprotein translocase subunit YajC [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368024|gb|EFP95567.1| preprotein translocase subunit YajC [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 109

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL- 79
            EM  +  + A+++YF++ RPQ ++++    ++ ++ +GD ++T+ G+VGK+ ++ ++  
Sbjct: 19  FEMLIMLGMFALIFYFMIYRPQAKRVKEHKNLMASMGKGDEVLTSGGLVGKITKITEEND 78

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + VE+  N  + + + FV+ V  K  
Sbjct: 79  YISVELNTNNEIVIKKDFVTAVLPKGT 105


>gi|109897554|ref|YP_660809.1| preprotein translocase subunit YajC [Pseudoalteromonas atlantica
           T6c]
 gi|332307526|ref|YP_004435377.1| preprotein translocase, YajC subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|109699835|gb|ABG39755.1| protein translocase subunit yajC [Pseudoalteromonas atlantica T6c]
 gi|332174855|gb|AEE24109.1| preprotein translocase, YajC subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 112

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
            EM  +  V  +++YF+L RPQ ++++    ++ +L +GD ++T  G+VG++V+V ++  
Sbjct: 22  FEMLIMLGVFGLIFYFMLYRPQAKRVKEHKNLVSSLSKGDEVLTQGGMVGRIVKVSEEKD 81

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            LE+ + +   + V +S +S V  K  
Sbjct: 82  FLEIALNDTTNIVVQKSAISAVLPKGT 108


>gi|187477348|ref|YP_785372.1| preprotein translocase subunit YajC [Bordetella avium 197N]
 gi|115421934|emb|CAJ48454.1| putative preprotein translocase YajC subunit [Bordetella avium
           197N]
          Length = 113

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 51/99 (51%), Gaps = 5/99 (5%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
                  + L       ++ V+ YFL+IRPQ ++ +    ++  L +GD +VTA GI+GK
Sbjct: 12  AQAAPEGNILGGILPIILMFVILYFLMIRPQMKRQKEHRNLVAALAKGDEVVTAGGILGK 71

Query: 72  VVRVIDDLELEVEIAE----NVRVRVVRSFVSEVQSKSE 106
           V +V  D  + +E+A+     V + + +S V+ V  K  
Sbjct: 72  VAKVT-DSYISIEVADLAEKPVEITLTKSSVTSVLPKGT 109


>gi|120613276|ref|YP_972954.1| protein translocase subunit yajC [Acidovorax citrulli AAC00-1]
 gi|120591740|gb|ABM35180.1| protein translocase subunit yajC [Acidovorax citrulli AAC00-1]
          Length = 91

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             S L       ++ VV YF++IRPQ ++ +    M+  + +GD + TA GI+GKV R+ 
Sbjct: 1   MMSSLTSMLPLVLMFVVLYFIMIRPQMKRQKEHRAMIDAIAKGDEVATAGGILGKVTRLS 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +   L +EIA  V V++ RS V++V  K  
Sbjct: 61  EGF-LHIEIASGVEVQIQRSAVAQVLPKGT 89


>gi|311108320|ref|YP_003981173.1| preprotein translocase, YajC subunit [Achromobacter xylosoxidans
           A8]
 gi|310763009|gb|ADP18458.1| preprotein translocase, YajC subunit [Achromobacter xylosoxidans
           A8]
          Length = 113

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
                  + L       ++ V+ YFL+IRPQ ++ +    ++  L +GD +VTA G++GK
Sbjct: 12  AQAAPEGNALMGMLPIILMFVILYFLMIRPQMKRQKEHRNLIAALAKGDEVVTAGGMLGK 71

Query: 72  VVRVIDDLELEVEIAE----NVRVRVVRSFVSEVQSKSE 106
           V +V +D  + VE++E     V V + +S VS V  K  
Sbjct: 72  VTKV-NDSYVTVEVSELADKPVEVIMQKSSVSTVLPKGT 109


>gi|194468329|ref|ZP_03074315.1| preprotein translocase, YajC subunit [Lactobacillus reuteri 100-23]
 gi|194453182|gb|EDX42080.1| preprotein translocase, YajC subunit [Lactobacillus reuteri 100-23]
          Length = 149

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 42/96 (43%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
             A ++  S      L  ++  + YF +IRPQ++Q +   EM+  L  GD +VT   + G
Sbjct: 10  GAASSNNASGYSGIILIILMVALMYFFMIRPQQKQRKEHQEMMNELHPGDEVVTIGRMHG 69

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           K+  +           E + +      ++ V  +++
Sbjct: 70  KIDSINKADRTVTLDCEGIYLTFDMVAIARVIKRAD 105


>gi|149194833|ref|ZP_01871927.1| preprotein translocase subunit YajC [Caminibacter mediatlanticus
           TB-2]
 gi|149134992|gb|EDM23474.1| preprotein translocase subunit YajC [Caminibacter mediatlanticus
           TB-2]
          Length = 103

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 57/98 (58%), Gaps = 1/98 (1%)

Query: 6   YAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTA 65
           +  ++  A     S +       +L  V+YFL+I PQ++Q ++  +M+ +L++GD IVT 
Sbjct: 3   FLYAEGAAAQGQPSLIASLLPLLILFAVFYFLVILPQQRQAKKHKQMVESLKKGDKIVTT 62

Query: 66  AGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            GI+ +VV+   D  ++ +IA+ V V++ ++ ++   +
Sbjct: 63  GGIIAEVVKNEPDF-IKAKIADGVEVKIDKAAIARKLN 99


>gi|153208369|ref|ZP_01946707.1| preprotein translocase, YajC subunit [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154707458|ref|YP_001424601.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|165919337|ref|ZP_02219423.1| preprotein translocase, YajC subunit [Coxiella burnetii RSA 334]
 gi|212218579|ref|YP_002305366.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
 gi|120576026|gb|EAX32650.1| preprotein translocase, YajC subunit [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154356744|gb|ABS78206.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|165916936|gb|EDR35540.1| preprotein translocase, YajC subunit [Coxiella burnetii RSA 334]
 gi|212012841|gb|ACJ20221.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
          Length = 116

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 51/102 (50%), Gaps = 1/102 (0%)

Query: 5   VYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVT 64
            YA               M  L  +L +V+YFLLIRPQ ++ +   ++L  +  GD +VT
Sbjct: 12  AYAAPVTAQAPHPGGFWSMLWLPLLLILVFYFLLIRPQTKRAKEHRQLLEGISLGDEVVT 71

Query: 65  AAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             G+V +V R+  D  + +EI++   + V ++ ++ V  K  
Sbjct: 72  TGGVVARVSRLK-DNFVVLEISKGTEITVQKASIASVLPKGT 112


>gi|85373545|ref|YP_457607.1| hypothetical protein ELI_03590 [Erythrobacter litoralis HTCC2594]
 gi|84786628|gb|ABC62810.1| YajC [Erythrobacter litoralis HTCC2594]
          Length = 106

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            A A             F  +A++++FL+IRPQ ++ +     +  +++GD +VTA G+V
Sbjct: 6   TAAASAEPPPFWVQILPFVGMALIFWFLIIRPQMKRQKEHQAKVAGIKKGDKVVTAGGLV 65

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           GKV++V DD   ++E+ + VRV+ V++ + ++    
Sbjct: 66  GKVIKV-DDHYADLELGQGVRVKAVKNTIGDIIPPG 100


>gi|312792585|ref|YP_004025508.1| preprotein translocase, yajc subunit [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179725|gb|ADQ39895.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 121

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 6/113 (5%)

Query: 1   MFTTVYA------QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLR 54
           +F   YA      Q  APA  +A + L       ++ VV Y L+I PQR++ ++  EM+ 
Sbjct: 7   LFEIAYAAGSQSSQQQAPAGATAIALLAQFIPLILMFVVLYLLIIVPQRRREKQFREMIN 66

Query: 55  NLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +L  GD IVT AGI+GK+V + DD+      A+ V++++ +  V EV  K+EP
Sbjct: 67  SLIVGDEIVTNAGIIGKIVNIKDDILTIEVGADRVKLKIYKWAVKEVLKKAEP 119


>gi|119384158|ref|YP_915214.1| preprotein translocase, YajC subunit [Paracoccus denitrificans
           PD1222]
 gi|119373925|gb|ABL69518.1| protein translocase subunit yajC [Paracoccus denitrificans PD1222]
          Length = 110

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 58/85 (68%), Gaps = 1/85 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
                 ++ V+ YFL+IRPQ+++++    M+  L++GD ++T  G++GKV  V +  ELE
Sbjct: 22  SFLPLILIFVIMYFLMIRPQQKRMKEHRAMVEALKKGDEVITQGGLIGKVTSVREG-ELE 80

Query: 83  VEIAENVRVRVVRSFVSEVQSKSEP 107
           VEIA  V+VRV+RS V+ + ++++P
Sbjct: 81  VEIAPGVKVRVIRSTVTGLVNRTQP 105


>gi|227540274|ref|ZP_03970323.1| possible preprotein translocase subunit [Sphingobacterium
          spiritivorum ATCC 33300]
 gi|300771098|ref|ZP_07080974.1| preprotein translocase [Sphingobacterium spiritivorum ATCC 33861]
 gi|227239810|gb|EEI89825.1| possible preprotein translocase subunit [Sphingobacterium
          spiritivorum ATCC 33300]
 gi|300761768|gb|EFK58588.1| preprotein translocase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 107

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 6/99 (6%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M +T++ Q+       +           ++ VV+YF +IRPQ ++ +   + +  L    
Sbjct: 1  MISTIFLQA-----GGSGGGFMTFLPMILIIVVFYFFMIRPQMKKQKDHKKYIEELGVNT 55

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVS 99
           IVT AGI G++V V +   L V++   V++R  +S ++
Sbjct: 56 KIVTTAGIHGRIVEVSETTFL-VDVGSGVKIRFDKSAIA 93


>gi|238019736|ref|ZP_04600162.1| hypothetical protein VEIDISOL_01611 [Veillonella dispar ATCC 17748]
 gi|237863777|gb|EEP65067.1| hypothetical protein VEIDISOL_01611 [Veillonella dispar ATCC 17748]
          Length = 96

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 57/84 (67%), Gaps = 1/84 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L+ +    ++ V++YFLL RPQ++Q + RA +L +L++G  IVT  GI G++V + DD +
Sbjct: 8   LQTSWPILLMVVIFYFLLWRPQKKQQKERANLLGSLKKGQKIVTIGGIYGEIVEL-DDEK 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSK 104
           ++V+++E V +   RS ++ V SK
Sbjct: 67  VKVQVSEKVELTFARSAIANVLSK 90


>gi|116872958|ref|YP_849739.1| hypothetical protein lwe1542 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116741836|emb|CAK20960.1| conserved hypothetical protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 111

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 2/92 (2%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             S +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I
Sbjct: 2   GGSGILAFVPIVLMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAI 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +D  + ++   N ++   R+ V  V  K   V
Sbjct: 61  EDGTVILK-CGNSKLTFDRNAVRTVLEKGNAV 91


>gi|313203079|ref|YP_004041736.1| protein translocase subunit yajc [Paludibacter propionicigenes
          WB4]
 gi|312442395|gb|ADQ78751.1| protein translocase subunit yajC [Paludibacter propionicigenes
          WB4]
          Length = 106

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 12 PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
           A   A     M  +  ++ VV+YF +IRPQ ++ +   +    ++ GDS+VT+ GI GK
Sbjct: 9  QAAAPAGGNYGMLIMMALVFVVFYFFMIRPQSKRQKEIKKQRDAMKAGDSVVTSGGIYGK 68

Query: 72 VVRVIDDLELEVEIAENVRVRVVRSFV 98
          V  V +   + +EIA+NVR++V ++ V
Sbjct: 69 VKDVKE-TTVTIEIADNVRIKVDKNSV 94


>gi|289523405|ref|ZP_06440259.1| preprotein translocase, YajC subunit [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503097|gb|EFD24261.1| preprotein translocase, YajC subunit [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 90

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 56/84 (66%), Gaps = 1/84 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M     +  V++YFLLIRPQ+++ ++  +ML +++RGD +VTA GI G V  V DD  + 
Sbjct: 1   MMWPLLLFIVIFYFLLIRPQKKRQKQHQDMLNSIKRGDQVVTAGGIFGTVRDVKDDSFI- 59

Query: 83  VEIAENVRVRVVRSFVSEVQSKSE 106
           +E+++ V+VRV+++ +S  +   E
Sbjct: 60  IEVSDGVKVRVLKNAISMKRGGGE 83


>gi|148543765|ref|YP_001271135.1| protein translocase subunit yajC [Lactobacillus reuteri DSM 20016]
 gi|184153171|ref|YP_001841512.1| preprotein translocase [Lactobacillus reuteri JCM 1112]
 gi|227363255|ref|ZP_03847387.1| protein translocase subunit yajC [Lactobacillus reuteri MM2-3]
 gi|325682137|ref|ZP_08161655.1| translocase subunit [Lactobacillus reuteri MM4-1A]
 gi|148530799|gb|ABQ82798.1| protein translocase subunit yajC [Lactobacillus reuteri DSM 20016]
 gi|183224515|dbj|BAG25032.1| preprotein translocase [Lactobacillus reuteri JCM 1112]
 gi|227071711|gb|EEI10002.1| protein translocase subunit yajC [Lactobacillus reuteri MM2-3]
 gi|324978781|gb|EGC15730.1| translocase subunit [Lactobacillus reuteri MM4-1A]
          Length = 154

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 42/96 (43%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
             A ++  S      L  ++  + YF +IRPQ++Q +   EM+  L  GD +VT   + G
Sbjct: 10  GAASSNNASGYSGIILIILMVALMYFFMIRPQQKQRKEHQEMMNELHPGDEVVTIGRMHG 69

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           K+  +           E + +      ++ V  +++
Sbjct: 70  KIDSINKADRTVTLDCEGIYLTFDMVAIARVIKRAD 105


>gi|121601937|ref|YP_988838.1| preprotein translocase, YajC subunit [Bartonella bacilliformis
           KC583]
 gi|120614114|gb|ABM44715.1| preprotein translocase, YajC subunit [Bartonella bacilliformis
           KC583]
          Length = 154

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/90 (48%), Positives = 65/90 (72%), Gaps = 1/90 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD- 78
                  F ++ V+ YFL+IRPQR Q+++R EML  +RRGD IVT  GI+GKV++V D+ 
Sbjct: 21  SFVTFIPFILIFVIMYFLIIRPQRVQMKKRQEMLNAVRRGDVIVTGGGIIGKVIKVHDEI 80

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            ELEVEI E++ +R++RS +++V+ K EPV
Sbjct: 81  GELEVEIGEDMHIRILRSTLADVRVKGEPV 110


>gi|226311459|ref|YP_002771353.1| hypothetical protein BBR47_18720 [Brevibacillus brevis NBRC 100599]
 gi|226094407|dbj|BAH42849.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 106

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++  ++YFLLIRPQ+++ ++R  ML  L++GD IVT  G+ G +  + D
Sbjct: 1   MDGLTQFLPIIIMFAIFYFLLIRPQQKKAKQRNAMLGALKKGDKIVTIGGVHGTIQELSD 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEV 101
           D  + + IA NV V   R  ++ V
Sbjct: 61  D-TVTLRIAHNVNVTFDRGAINNV 83


>gi|224373499|ref|YP_002607871.1| preprotein translocase, YajC subunit [Nautilia profundicola AmH]
 gi|223589223|gb|ACM92959.1| preprotein translocase, YajC subunit [Nautilia profundicola AmH]
          Length = 102

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 58/101 (57%), Gaps = 4/101 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
             +YAQ+         S L       +L  ++YFL+I PQ++Q ++  +M+  L++GD I
Sbjct: 2   NFLYAQA---PQAGQPSILASLLPLIILFAIFYFLVILPQQRQAKKHKQMVEELKKGDKI 58

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           +T  GI+ +VV+   D  L+V++ +NV V++ +S V+   +
Sbjct: 59  ITTGGIIAEVVKNEPDF-LKVKLNDNVEVKLDKSAVARKLN 98


>gi|16272201|ref|NP_438411.1| preprotein translocase subunit YajC [Haemophilus influenzae Rd
           KW20]
 gi|145628559|ref|ZP_01784359.1| preprotein translocase subunit YajC [Haemophilus influenzae
           22.1-21]
 gi|145639847|ref|ZP_01795448.1| preprotein translocase subunit YajC [Haemophilus influenzae PittII]
 gi|260580875|ref|ZP_05848700.1| preprotein translocase, YajC subunit [Haemophilus influenzae RdAW]
 gi|1175517|sp|P44592|Y241_HAEIN RecName: Full=UPF0092 membrane protein HI_0241
 gi|1573206|gb|AAC21909.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|144979029|gb|EDJ88715.1| preprotein translocase subunit YajC [Haemophilus influenzae
           22.1-21]
 gi|145271065|gb|EDK10981.1| preprotein translocase subunit YajC [Haemophilus influenzae PittII]
 gi|260092498|gb|EEW76436.1| preprotein translocase, YajC subunit [Haemophilus influenzae RdAW]
 gi|309750342|gb|ADO80326.1| General secretory pathway component YajC [Haemophilus influenzae
           R2866]
          Length = 97

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           A SP+    +F +  +++YF++ RPQ ++ +   +++  L +G  ++TA G++GK+ +V 
Sbjct: 3   AQSPMSTLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLTAGGVIGKITKVT 62

Query: 77  DD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
           +    + + + +   + + R+++  V  K 
Sbjct: 63  EGSDSIVIALNDTTEITINRNYIVSVLPKG 92


>gi|302339724|ref|YP_003804930.1| preprotein translocase, YajC subunit [Spirochaeta smaragdinae DSM
           11293]
 gi|301636909|gb|ADK82336.1| preprotein translocase, YajC subunit [Spirochaeta smaragdinae DSM
           11293]
          Length = 122

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A   A A   +   +     F ++ +++YFL+IRPQ ++ +    ML  L++GD +V+  
Sbjct: 14  APEGAAASGGSGQMMTTFVTFGLVILIFYFLIIRPQNKKQKDAKRMLEALKKGDRVVSIG 73

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           GI G VV V  D  + +++ +N ++   +S +S V  + 
Sbjct: 74  GIRGTVVSVK-DQTVVLKVDDNTKLEFTKSAISTVVEQG 111


>gi|28897363|ref|NP_796968.1| preprotein translocase subunit YajC [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838084|ref|ZP_01990751.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           AQ3810]
 gi|260364492|ref|ZP_05777113.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           K5030]
 gi|260876324|ref|ZP_05888679.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|260898595|ref|ZP_05907091.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|260899305|ref|ZP_05907700.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           AQ4037]
 gi|28805575|dbj|BAC58852.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748551|gb|EDM59410.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           AQ3810]
 gi|308086864|gb|EFO36559.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|308093019|gb|EFO42714.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|308106600|gb|EFO44140.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           AQ4037]
 gi|308114694|gb|EFO52234.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus
           K5030]
 gi|328472613|gb|EGF43476.1| preprotein translocase subunit YajC [Vibrio parahaemolyticus 10329]
          Length = 109

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL- 79
            EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T+ G+VGK+ ++ +D  
Sbjct: 19  FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKNLMSSMGKGDEVLTSGGLVGKITKIAEDND 78

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + F++ V  K  
Sbjct: 79  YISIELNANNEVVIKKDFITAVLPKGT 105


>gi|327398932|ref|YP_004339801.1| preprotein translocase subunit YajC [Hippea maritima DSM 10411]
 gi|327181561|gb|AEA33742.1| preprotein translocase, YajC subunit [Hippea maritima DSM 10411]
          Length = 100

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 59/100 (59%), Gaps = 2/100 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF+ V  ++ A    +  S         ++ VV+Y  LI PQ++Q ++  E + +L+RGD
Sbjct: 1   MFSLV-PEAFAAGSAAQPSMWAQIIPLILIVVVFYVFLILPQQKQRKKHQEFINSLKRGD 59

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
            I+T++GI G + +V +D  + +EIA+ V++++ ++ V  
Sbjct: 60  KIITSSGIYGTITKVNEDNFV-IEIADGVQIKISKNSVVS 98


>gi|312623285|ref|YP_004024898.1| preprotein translocase, yajc subunit [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203752|gb|ADQ47079.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 121

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 63/113 (55%), Gaps = 6/113 (5%)

Query: 1   MFTTVYA------QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLR 54
           +F   YA      Q  AP   +A + L       ++ VV Y L+I PQR++ ++  EM+ 
Sbjct: 7   LFDFAYAAGNQSSQQQAPPGATAIALLAQFIPLILMFVVLYLLIIVPQRRREKQFREMIN 66

Query: 55  NLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +L  GD IVT AGI+GK+V + DD+      A+ V++++ +  V EV  K+EP
Sbjct: 67  SLIVGDEIVTNAGIIGKIVNIKDDILTIEVGADRVKLKIYKWAVKEVLKKAEP 119


>gi|300310568|ref|YP_003774660.1| preprotein translocase transmembrane protein [Herbaspirillum
           seropedicae SmR1]
 gi|300073353|gb|ADJ62752.1| preprotein translocase transmembrane protein [Herbaspirillum
           seropedicae SmR1]
          Length = 110

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L       ++ VV YFL+IRPQ ++ + +  M+  L +GD +VT+ G++G++ +V  D  
Sbjct: 22  LASFLPIILMFVVLYFLMIRPQMKRQKEQKAMMDALAKGDEVVTSGGMLGRITKVA-DGY 80

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +E++E   + V +  V+ +  K  
Sbjct: 81  ITIEVSEGTEIIVQKGAVTTLLPKGT 106


>gi|170740721|ref|YP_001769376.1| preprotein translocase, YajC subunit [Methylobacterium sp. 4-46]
 gi|168194995|gb|ACA16942.1| preprotein translocase, YajC subunit [Methylobacterium sp. 4-46]
          Length = 111

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 73/109 (66%), Gaps = 2/109 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M T  +      A    T  +     F ++ V+ YFL++RPQ+++ +   +M++N+RRGD
Sbjct: 1   MITPAF-AQGTGAAAGGTDVILQVVPFVLIFVIMYFLILRPQQKRAREHQDMVKNVRRGD 59

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +IVT  GIVG+V +V D+  E+EVEIAE VRV+VVR+ ++EV++K EPV
Sbjct: 60  TIVTTGGIVGRVAKVADEASEIEVEIAEGVRVKVVRTMIAEVRAKGEPV 108


>gi|330807628|ref|YP_004352090.1| Sec protein secretion system, subunit yajC [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327375736|gb|AEA67086.1| Putative Sec protein secretion system, subunit yajC [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 112

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L NL++GD +VT  GI GK+ +V DD  + +E
Sbjct: 28  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLSNLQKGDEVVTTGGIAGKITKVADDF-VVLE 86

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V ++  +  ++    K  
Sbjct: 87  VSDTVEMKFQKGAIAATLPKGT 108


>gi|83647162|ref|YP_435597.1| preprotein translocase, YajC subunit [Hahella chejuensis KCTC 2396]
 gi|83635205|gb|ABC31172.1| preprotein translocase, YajC subunit [Hahella chejuensis KCTC 2396]
          Length = 122

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S +          +++YFL+ RPQ ++ +   E+L  L + D ++   GI GK+VRV
Sbjct: 29  QGPSAVMQILFLGGFVLIFYFLVWRPQSKRAKEHRELLSGLNKNDEVLVNGGIAGKIVRV 88

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            DD  L VEIA+ V ++V +  V+    K  
Sbjct: 89  KDDF-LVVEIADKVEIKVQKMAVTAALPKGT 118


>gi|294055367|ref|YP_003549025.1| preprotein translocase, YajC subunit [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614700|gb|ADE54855.1| preprotein translocase, YajC subunit [Coraliomargarita akajimensis
           DSM 45221]
          Length = 108

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 53/96 (55%), Gaps = 2/96 (2%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
                A   L     F +L    +FL+I PQR++ ++  +M+  L+ GD +VT+ GI G 
Sbjct: 13  AQAAPAGGGLAQFLPFILLFAGMWFLIIAPQRKRQKQHDQMITELKTGDEVVTSGGIYGT 72

Query: 72  VVRVIDDLELEVEIAENVRVRVVRSFV-SEVQSKSE 106
           +  V +D  + V +A+N ++ + ++ + S+V +K +
Sbjct: 73  ITNVKEDRFV-VRVADNTKIELSKASIGSKVAAKGD 107


>gi|148554372|ref|YP_001261954.1| protein translocase subunit yajC [Sphingomonas wittichii RW1]
 gi|148499562|gb|ABQ67816.1| protein translocase subunit yajC [Sphingomonas wittichii RW1]
          Length = 112

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 74/106 (69%), Gaps = 2/106 (1%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF +  YAQ+   A +S+ S + M G F ++ V++YFLLIRPQ+++ +     +  +++ 
Sbjct: 1   MFASPAYAQAAGAAGSSSGSTIFMLGQFVLIGVIFYFLLIRPQQKRAKEHRATIDAVKKN 60

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           D IVTA GIV KVV+V D+ E+EVEIA NV++++V++ +++V++  
Sbjct: 61  DVIVTAGGIVAKVVKV-DETEVEVEIAPNVKIKIVKATIADVRTAG 105


>gi|121606774|ref|YP_984103.1| preprotein translocase subunit YajC [Polaromonas naphthalenivorans
           CJ2]
 gi|120595743|gb|ABM39182.1| protein translocase subunit yajC [Polaromonas naphthalenivorans
           CJ2]
          Length = 93

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            S L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA G++GKV+R+ +
Sbjct: 1   MSTLTGMLPLVLMFVVLYFVMIRPQMRKQKEHRTMIEALAKGDEVATAGGLLGKVIRLGE 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKS 105
              L +EI+  V V++ RS + +V  K 
Sbjct: 61  G-YLTLEISPGVEVQLQRSAIVQVLPKG 87


>gi|262371075|ref|ZP_06064397.1| preprotein translocase [Acinetobacter johnsonii SH046]
 gi|262313961|gb|EEY95006.1| preprotein translocase [Acinetobacter johnsonii SH046]
          Length = 109

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 53/105 (50%), Gaps = 4/105 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +T +A  +A       S +    +  V   ++YFL+ RPQ ++ +    ++ +L  G  
Sbjct: 5   ISTAHAAGEAAQ---QPSMVANLLMIAVFIAIFYFLIWRPQAKRAKEHRSLVESLGVGSE 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +V A G++GK+ ++  D  + VE++  V V++ R+ V  V  +  
Sbjct: 62  VVFAGGLMGKITKLEGDFAV-VELSRGVDVKIQRASVISVLPEGT 105


>gi|242279107|ref|YP_002991236.1| preprotein translocase, YajC subunit [Desulfovibrio salexigens DSM
           2638]
 gi|242122001|gb|ACS79697.1| preprotein translocase, YajC subunit [Desulfovibrio salexigens DSM
           2638]
          Length = 116

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 53/84 (63%), Gaps = 1/84 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++  ++YFLLIRPQ+++ +    ML  ++RGD ++TA GI G+V  V D
Sbjct: 22  MGALGSFLPLILMFAIFYFLLIRPQQKKAKEHKAMLDAIQRGDRVLTAGGIYGRVTAV-D 80

Query: 78  DLELEVEIAENVRVRVVRSFVSEV 101
             EL VE+AE ++V+V RSFVS +
Sbjct: 81  GDELTVELAEGMQVKVERSFVSNL 104


>gi|146283380|ref|YP_001173533.1| preprotein translocase subunit YajC [Pseudomonas stutzeri A1501]
 gi|145571585|gb|ABP80691.1| preprotein translocase, YajC subunit [Pseudomonas stutzeri A1501]
          Length = 109

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                           +++Y ++ RPQ ++ +    ++  L++GD +VT+ GI GKV +V
Sbjct: 16  GPAGTGFEWVFLVGFLIIFYLMIWRPQAKRAKEHKNLVAGLQKGDEVVTSGGIAGKVTKV 75

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            DD  + +E+++NV ++  +  ++    K  
Sbjct: 76  ADDF-VVIEVSDNVELKFQKVAIAATLPKGT 105


>gi|110833363|ref|YP_692222.1| preprotein translocase subunit YajC [Alcanivorax borkumensis SK2]
 gi|110646474|emb|CAL15950.1| preprotein translocase, YajC subunit [Alcanivorax borkumensis SK2]
          Length = 120

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +  V+ VV+YF LIRPQ+++ +    ++++L +GD +VT+ GI+GKV +V DD  + V
Sbjct: 35  LIMLVVMMVVFYFFLIRPQQKRAKEHKNLVQSLSKGDEVVTSGGILGKVAKVTDDF-VVV 93

Query: 84  EIAENVRVRVVRSFVSEVQSKSE 106
           EI+ N+ +++ +S V     K  
Sbjct: 94  EISNNLEIKLQKSSVQATLPKGT 116


>gi|163857961|ref|YP_001632259.1| hypothetical protein Bpet3648 [Bordetella petrii DSM 12804]
 gi|163261689|emb|CAP43991.1| yajC [Bordetella petrii]
          Length = 113

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 5/99 (5%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
                    L       ++ V+ YFL+IRPQ ++ +    ++ NL +GD ++TA G++GK
Sbjct: 12  AQAAPEGGALMGMLPIVLMFVILYFLMIRPQMKRQKEHRNLVANLAKGDEVMTAGGMLGK 71

Query: 72  VVRVIDDLELEVEIA----ENVRVRVVRSFVSEVQSKSE 106
           V +V  D  + VE+A    + V V + ++ VS V  K  
Sbjct: 72  VSKVT-DTYITVEVAQLADKPVEVLMQKTSVSSVLPKGT 109


>gi|322419804|ref|YP_004199027.1| preprotein translocase subunit YajC [Geobacter sp. M18]
 gi|320126191|gb|ADW13751.1| preprotein translocase, YajC subunit [Geobacter sp. M18]
          Length = 107

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 5/105 (4%)

Query: 1   MFTTVYAQSDAPAITSATSP----LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNL 56
           M    +A +       A        +       +  ++YFLLIRPQ+++ +    +L  L
Sbjct: 1   MLGLAFAMAGPQGGAPAGGGMMAQFQGLIPLVFMFAIFYFLLIRPQQKKAKEHRALLEAL 60

Query: 57  RRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           ++GD +VTA G+ GKV  + DD  + +EIA  V VR+ + +++ V
Sbjct: 61  KKGDQVVTAGGMHGKVTAL-DDQVVTLEIAPGVNVRINKGYIASV 104


>gi|190571618|ref|YP_001975976.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213019020|ref|ZP_03334827.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|190357890|emb|CAQ55350.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212995129|gb|EEB55770.1| preprotein translocase, YajC subunit [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 137

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/104 (29%), Positives = 68/104 (65%), Gaps = 4/104 (3%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            + V+A   A A  + ++ +       ++ VV+YFL+IRP  ++L+    M+  ++RGD+
Sbjct: 3   ISEVFA---ADATNNVSASVASFIPLILIFVVFYFLIIRPNHKKLKEHRRMIDQIKRGDT 59

Query: 62  IVTAAGIVGKVVRVID-DLELEVEIAENVRVRVVRSFVSEVQSK 104
           ++T++GI+G+V +V + + +L +EIA  + +++++S +SE+ +K
Sbjct: 60  VITSSGIIGEVNKVDEVNAQLILEIAPKIEIKILKSAISEILNK 103


>gi|319957742|ref|YP_004169005.1| protein translocase subunit yajc [Nitratifractor salsuginis DSM
           16511]
 gi|319420146|gb|ADV47256.1| protein translocase subunit yajC [Nitratifractor salsuginis DSM
           16511]
          Length = 89

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 58/89 (65%), Gaps = 1/89 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           +   L       +L V+++FL+IRPQ++Q +   EML +L++GD IVT  G++ +VV+  
Sbjct: 2   SQGALAQFLPLILLFVIFWFLIIRPQQKQQKAHKEMLASLKKGDRIVTNGGLIAEVVKPE 61

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +D  L++++ ++  VR+ R++V+   +++
Sbjct: 62  ED-YLKIKLNDDTIVRLDRNYVARKLNEA 89


>gi|77460841|ref|YP_350348.1| preprotein translocase subunit YajC [Pseudomonas fluorescens Pf0-1]
 gi|77384844|gb|ABA76357.1| putative membrane protein [Pseudomonas fluorescens Pf0-1]
          Length = 111

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L +L++GD +VT  GI GK+ +V DD  + +E
Sbjct: 27  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLSSLQKGDEVVTTGGIAGKITKVADDF-VVLE 85

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V ++  +  ++    K  
Sbjct: 86  VSDTVEMKFQKGAIAATLPKGT 107


>gi|227544207|ref|ZP_03974256.1| translocase subunit YajC protein [Lactobacillus reuteri CF48-3A]
 gi|300908203|ref|ZP_07125669.1| translocase subunit [Lactobacillus reuteri SD2112]
 gi|62422046|gb|AAX82605.1| putative protein translocase subunit YajC [Lactobacillus reuteri]
 gi|227185800|gb|EEI65871.1| translocase subunit YajC protein [Lactobacillus reuteri CF48-3A]
 gi|300894630|gb|EFK87986.1| translocase subunit [Lactobacillus reuteri SD2112]
          Length = 154

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 42/96 (43%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
             A ++  S      L  ++  + YF +IRPQ++Q +   EM+  L  GD +VT   + G
Sbjct: 10  GAASSNNASGYSGIILIILMVALMYFFMIRPQQKQRKEHQEMMNELHPGDEVVTIGRMHG 69

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           K+  +           E + +      ++ V  +++
Sbjct: 70  KIDSINKADRTVTLDCEGIYLTFDMVAIARVIKRAD 105


>gi|302342505|ref|YP_003807034.1| preprotein translocase, YajC subunit [Desulfarculus baarsii DSM
           2075]
 gi|301639118|gb|ADK84440.1| preprotein translocase, YajC subunit [Desulfarculus baarsii DSM
           2075]
          Length = 125

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEM---AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           T   AQ  A     +     +     +  ++ VV+YFLLIRPQ+++ +   EML NL+ G
Sbjct: 8   TNAMAQEAAGGAAPSGIAGMLTGPLPMLVLMFVVFYFLLIRPQQKKTKAHREMLGNLKAG 67

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           D IVT+ GI G++  +  D  + VEIA  VR++V R  V+ +
Sbjct: 68  DQIVTSGGIFGRITGLT-DQTVVVEIAPQVRIKVQRGAVAGL 108


>gi|261856763|ref|YP_003264046.1| preprotein translocase, YajC subunit [Halothiobacillus neapolitanus
           c2]
 gi|261837232|gb|ACX96999.1| preprotein translocase, YajC subunit [Halothiobacillus neapolitanus
           c2]
          Length = 113

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              + +       ++  V YFLLIRPQ ++ +   +++ ++ +GD I+T  G++G+V++V
Sbjct: 17  QQPNMIATFLPLILIFGVMYFLLIRPQVKRQKELKKLVESIEKGDEIITNGGLLGRVIKV 76

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            D   L VE+A+ + + V R  VS V  K  
Sbjct: 77  TDAF-LIVEVADGMTIVVQRGAVSSVMPKGT 106


>gi|27904628|ref|NP_777754.1| putative membrane protein YajC [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
 gi|46397199|sp|Q89AV7|Y125_BUCBP RecName: Full=UPF0092 membrane protein bbp_125
 gi|27904025|gb|AAO26859.1| putative membrane protein YajC [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 115

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            + +YA  ++  I S+ S   +  +  V   ++YF++ RPQR+++Q    ++++L  GD 
Sbjct: 5   ISHIYAVENSTTIPSSNS-YSLIFMLLVFLSIFYFMIFRPQRKKIQEHDRLIKSLSYGDE 63

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           + T++G VGK+V++     + +E+  NV V V   F+  +  K  
Sbjct: 64  VFTSSGFVGKIVKITKTGYIVLELNNNVEVFVKSDFIVSIFPKGT 108


>gi|312870478|ref|ZP_07730598.1| preprotein translocase, YajC subunit [Lactobacillus oris
           PB013-T2-3]
 gi|311094035|gb|EFQ52359.1| preprotein translocase, YajC subunit [Lactobacillus oris
           PB013-T2-3]
          Length = 147

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 43/92 (46%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             + T       L  ++  + YF +IRPQ++Q ++  EM+  L +GD +VT   + GK+ 
Sbjct: 12  AAANTGGYSSIILIVLMIALMYFFMIRPQQKQRKQHQEMMNELHKGDEVVTIGRLHGKID 71

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            V  + +      E + +      ++ V  ++
Sbjct: 72  EVNKENQTVTLDCEGIYLTFDMVAIARVLKRA 103


>gi|255003428|ref|ZP_05278392.1| preprotein translocase subunit (yajC) [Anaplasma marginale str.
           Puerto Rico]
 gi|255004548|ref|ZP_05279349.1| preprotein translocase subunit (yajC) [Anaplasma marginale str.
           Virginia]
          Length = 130

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 57/91 (62%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              + +       ++ +++YFL+IRPQ+++L+   ++L ++++GD ++ + G+ G V +V
Sbjct: 21  GLGASIAGFAPLVLIFLIFYFLVIRPQQKKLREHNKLLDSIKKGDKVIASGGLFGTVTKV 80

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
              +  L +EIA  V VRV++S VSEV ++ 
Sbjct: 81  DASNGHLHIEIATGVEVRVLKSSVSEVLNRD 111


>gi|52842219|ref|YP_096018.1| transmembrane protein YajC, preprotein translocase subunit
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54294899|ref|YP_127314.1| hypothetical protein lpl1978 [Legionella pneumophila str. Lens]
 gi|54297928|ref|YP_124297.1| hypothetical protein lpp1983 [Legionella pneumophila str. Paris]
 gi|148359573|ref|YP_001250780.1| preprotein translocase subunit [Legionella pneumophila str. Corby]
 gi|296107615|ref|YP_003619316.1| preprotein translocase YajC subunit [Legionella pneumophila 2300/99
           Alcoy]
 gi|52629330|gb|AAU28071.1| transmembrane protein YajC, preprotein translocase subunit
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|53751713|emb|CAH13135.1| hypothetical protein lpp1983 [Legionella pneumophila str. Paris]
 gi|53754731|emb|CAH16218.1| hypothetical protein lpl1978 [Legionella pneumophila str. Lens]
 gi|148281346|gb|ABQ55434.1| transmembrane protein YajC, preprotein translocase subunit
           [Legionella pneumophila str. Corby]
 gi|295649517|gb|ADG25364.1| preprotein translocase YajC subunit [Legionella pneumophila 2300/99
           Alcoy]
 gi|307610726|emb|CBX00333.1| hypothetical protein LPW_20591 [Legionella pneumophila 130b]
          Length = 111

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            T       +   + V++YF++IRPQ ++ +   E++  L++GD IVT+ GI+ KVV + 
Sbjct: 19  QTDGTFSLIMIVAIFVLFYFMIIRPQSKRAKEHRELINRLKKGDEIVTSGGILAKVVSL- 77

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           DD  ++V  AE + + + +  V+ V  K  
Sbjct: 78  DDQYIKVSPAEGIEINLQKGAVTAVLPKGT 107


>gi|254995249|ref|ZP_05277439.1| preprotein translocase subunit (yajC) [Anaplasma marginale str.
           Mississippi]
 gi|269958516|ref|YP_003328303.1| preprotein translocase, YajC subunit [Anaplasma centrale str.
           Israel]
 gi|269848345|gb|ACZ48989.1| preprotein translocase, YajC subunit [Anaplasma centrale str.
           Israel]
          Length = 130

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 57/91 (62%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              + +       ++ +++YFL+IRPQ+++L+   ++L ++++GD ++ + G+ G V +V
Sbjct: 21  GLGASIAGFAPLVLIFLIFYFLVIRPQQKKLREHNKLLDSIKKGDKVIASGGLFGTVTKV 80

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
              +  L +EIA  V VRV++S VSEV ++ 
Sbjct: 81  DASNGHLHIEIATGVEVRVLKSSVSEVLNRD 111


>gi|91790475|ref|YP_551427.1| protein translocase subunit yajC [Polaromonas sp. JS666]
 gi|91699700|gb|ABE46529.1| protein translocase subunit yajC [Polaromonas sp. JS666]
          Length = 94

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA G++GKV ++  D
Sbjct: 3   SSLTGMLPLVLMFVVLYFVMIRPQMKKQKEHRAMIDALAKGDEVATAGGLLGKVTKL-GD 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKS 105
           + L +E+A  V V++ RS + +V  K 
Sbjct: 62  VYLSLELAPGVEVQLQRSAIIQVLPKG 88


>gi|116629087|ref|YP_814259.1| preprotein translocase subunit YajC [Lactobacillus gasseri ATCC
           33323]
 gi|116094669|gb|ABJ59821.1| protein translocase subunit yajC [Lactobacillus gasseri ATCC 33323]
          Length = 150

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
               +  + + M      + V +YF +I+PQ++Q Q R +M+  L++GD ++   G+ GK
Sbjct: 12  AQSAAGMNNMFMIIAMIAIFVFFYFSMIKPQKKQQQERMKMMSELKKGDQVIMVDGLHGK 71

Query: 72  VVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           V  + D  +  V  A+ + +   R  +  V  
Sbjct: 72  VDSINDADKTVVIDADGIFLTFERMAIRRVLP 103


>gi|147677368|ref|YP_001211583.1| preprotein translocase subunit YajC [Pelotomaculum
           thermopropionicum SI]
 gi|146273465|dbj|BAF59214.1| preprotein translocase subunit YajC [Pelotomaculum
           thermopropionicum SI]
          Length = 98

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 54/88 (61%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S +        L  + YFL+IRPQ+Q+ ++  EMLR L+  D ++T  GI G VV++ DD
Sbjct: 5   SQMISLLYIIGLFALLYFLMIRPQQQRQKKHQEMLRKLKPDDRVITIGGIYGTVVKIKDD 64

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             + + +A+NVR+  ++S +S+V +  E
Sbjct: 65  S-VILRVADNVRMEFLKSAISQVTASKE 91


>gi|323491587|ref|ZP_08096766.1| preprotein translocase subunit YajC [Vibrio brasiliensis LMG 20546]
 gi|323314163|gb|EGA67248.1| preprotein translocase subunit YajC [Vibrio brasiliensis LMG 20546]
          Length = 109

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL- 79
            EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T+ G+VGK+ ++ +D  
Sbjct: 19  FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKNLMASMGKGDEVLTSGGLVGKITKIAEDND 78

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + FV+ V  K  
Sbjct: 79  YISIELNTNNEVVIKKDFVTAVLPKGT 105


>gi|254490681|ref|ZP_05103866.1| preprotein translocase, YajC subunit [Methylophaga thiooxidans
           DMS010]
 gi|224464137|gb|EEF80401.1| preprotein translocase, YajC subunit [Methylophaga thiooxydans
           DMS010]
          Length = 112

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA +      + +  +       +L V++Y +LIRPQ+++ +    M   L +GD 
Sbjct: 5   ISAAYAGAAESQAAAGSPGILDFAFPIILLVLFYVMLIRPQQKRAKEHRTMQSALAKGDE 64

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G++GK++ +  D  + V+IAE+V V+V R  ++ V  K  
Sbjct: 65  VVTDGGLMGKILEIT-DNAITVQIAESVEVKVRRESINAVLPKGT 108


>gi|332884937|gb|EGK05192.1| hypothetical protein HMPREF9456_03105 [Dysgonomonas mossii DSM
           22836]
          Length = 112

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
             +PA         M  +  +L  + YF +IRPQ+++ +   E    ++ GD +VTA G+
Sbjct: 14  GASPAGGLLGGSTGMIIMMVLLFGIMYFFMIRPQQKKQKALQEARNAIKVGDKVVTAGGV 73

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
            GKV  V  D    +EIAE V++++ +S V
Sbjct: 74  HGKVKEV-GDTYFILEIAEGVKIKIEKSSV 102


>gi|300362256|ref|ZP_07058432.1| preprotein translocase [Lactobacillus gasseri JV-V03]
 gi|300353247|gb|EFJ69119.1| preprotein translocase [Lactobacillus gasseri JV-V03]
          Length = 150

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
               +  + + M      + V +YF +I+PQ++Q Q R +M+  L++GD ++   G+ GK
Sbjct: 12  AQSAAGMNNMFMIIAMIAIFVFFYFSMIKPQKKQQQERMKMMSELKKGDQVIMVDGLHGK 71

Query: 72  VVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           V  + D  +  V  A+ + +   R  +  V  
Sbjct: 72  VDSINDADKTVVIDADGIFLTFERMAIRRVLP 103


>gi|212212456|ref|YP_002303392.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
 gi|212010866|gb|ACJ18247.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
          Length = 116

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 1/102 (0%)

Query: 5   VYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVT 64
           VYA         +     M  L  +L +V+YFLLIRPQ ++ +   ++L  +  GD +VT
Sbjct: 12  VYAAPVTAQAPHSGGFWSMLWLPLLLILVFYFLLIRPQSKRAKEHRQLLEGISLGDEVVT 71

Query: 65  AAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             G+V +V R+  D  + +EI++   + V ++ ++ V  K  
Sbjct: 72  TGGVVARVSRLK-DNFVVLEISKGTEITVQKASIASVLPKGT 112


>gi|68171926|ref|ZP_00545243.1| YajC [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658288|ref|YP_507794.1| preprotein translocase, YajC subunit [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67772420|gb|AAY79410.1| pOMP [Ehrlichia chaffeensis]
 gi|67998648|gb|EAM85384.1| YajC [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599745|gb|ABD45214.1| preprotein translocase, YajC subunit [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 125

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 55/91 (60%), Gaps = 1/91 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +   S +       ++  V+YF +IRPQ+++++   ++L N+++GD +V +  I+G V +
Sbjct: 18  SGIGSSIAGLIPLVLIFCVFYFFIIRPQQKKIKEHNKLLDNIKKGDKVVISGSILGSVTK 77

Query: 75  VIDDL-ELEVEIAENVRVRVVRSFVSEVQSK 104
           V        VEI+E V V+V++S VSEV +K
Sbjct: 78  VDTTNGHFIVEISEGVEVKVLKSSVSEVLNK 108


>gi|118474680|ref|YP_891902.1| preprotein translocase subunit YajC [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118413906|gb|ABK82326.1| preprotein translocase, YajC subunit [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 93

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/90 (35%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
               +       VL  ++YFL+IRPQ++Q +    ML NL++GD IVT  G+  +VV+  
Sbjct: 1   MPEIVSSLLPLIVLFAIFYFLVIRPQQKQQKEHRNMLSNLQKGDKIVTNGGLFCEVVK-P 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +D  ++V++ + V VR+ R+FV++   K E
Sbjct: 60  EDDFIKVKLNDEVIVRIDRNFVAKKIDKIE 89


>gi|254506776|ref|ZP_05118916.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus 16]
 gi|323499866|ref|ZP_08104825.1| preprotein translocase subunit YajC [Vibrio sinaloensis DSM 21326]
 gi|219550357|gb|EED27342.1| preprotein translocase, YajC subunit [Vibrio parahaemolyticus 16]
 gi|323315107|gb|EGA68159.1| preprotein translocase subunit YajC [Vibrio sinaloensis DSM 21326]
          Length = 109

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL- 79
            EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T+ G+VGK+ ++ +D  
Sbjct: 19  FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKSLMSSMGKGDEVLTSGGLVGKITKIAEDND 78

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + FV+ V  K  
Sbjct: 79  YISIELNTNNEVVIKKDFVTAVLPKGT 105


>gi|332288530|ref|YP_004419382.1| preprotein translocase subunit YajC [Gallibacterium anatis UMN179]
 gi|330431426|gb|AEC16485.1| preprotein translocase subunit YajC [Gallibacterium anatis UMN179]
          Length = 110

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                L+M  L  +  +++YF++ RPQ ++ ++  E++ +L +G+ ++T+ G++GK+ +V
Sbjct: 15  QQGGGLQMIFLLVIFGLIFYFMIFRPQSKRNKQHRELMSSLAKGEEVLTSGGLLGKITKV 74

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
             +   + + + +   V + + F+  V  K 
Sbjct: 75  SAESDYIVIALNDTNEVTIKKDFIVAVLPKG 105


>gi|114570450|ref|YP_757130.1| protein translocase subunit YajC [Maricaulis maris MCS10]
 gi|114340912|gb|ABI66192.1| protein translocase subunit yajC [Maricaulis maris MCS10]
          Length = 113

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 62/86 (72%), Gaps = 1/86 (1%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
               +  ++ +V+YFLLIRPQ+++++   E++  L+RGD ++T  G++GK+ +V D+ E+
Sbjct: 7   SPIPMLVLMGLVFYFLLIRPQQKRMKEHKELIGGLKRGDEVITQGGMIGKIAKVSDE-EV 65

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEP 107
            ++I E V+VR+VRS +++V+ ++ P
Sbjct: 66  TLDIGEGVKVRIVRSTIADVKGRTAP 91


>gi|91225156|ref|ZP_01260378.1| preprotein translocase subunit YajC [Vibrio alginolyticus 12G01]
 gi|262395135|ref|YP_003286989.1| preprotein translocase subunit YajC [Vibrio sp. Ex25]
 gi|269965154|ref|ZP_06179288.1| preprotein translocase subunit YajC [Vibrio alginolyticus 40B]
 gi|91190099|gb|EAS76370.1| preprotein translocase subunit YajC [Vibrio alginolyticus 12G01]
 gi|262338729|gb|ACY52524.1| preprotein translocase subunit YajC [Vibrio sp. Ex25]
 gi|269830140|gb|EEZ84367.1| preprotein translocase subunit YajC [Vibrio alginolyticus 40B]
          Length = 109

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL- 79
            EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T+ G+VGK+ ++ +D  
Sbjct: 19  FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKNLMASMGKGDEVLTSGGLVGKITKIAEDND 78

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + F++ V  K  
Sbjct: 79  YISIELNANNEVVIKKDFITAVLPKGT 105


>gi|134093585|ref|YP_001098660.1| putative preprotein translocase subunit YajC [Herminiimonas
           arsenicoxydans]
 gi|133737488|emb|CAL60531.1| putative Preprotein translocase subunit YajC [Herminiimonas
           arsenicoxydans]
          Length = 108

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +     L       ++ V  YFL+IRPQ ++ +    M+  + RGD +VT+ G++GKV +
Sbjct: 14  SGIMGSLTQFVPILLMFVALYFLMIRPQMKRQKEHKLMVEAVTRGDEVVTSGGVLGKVTK 73

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           V  D+ + +E+ E   + + +S ++ +  K  
Sbjct: 74  VS-DVYVSIEVQEGTELVLQKSAITTLLPKGT 104


>gi|117926492|ref|YP_867109.1| protein translocase subunit yajC [Magnetococcus sp. MC-1]
 gi|117610248|gb|ABK45703.1| protein translocase subunit yajC [Magnetococcus sp. MC-1]
          Length = 133

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 65/117 (55%), Gaps = 14/117 (11%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +    +AQ            ++      +L V+ YFLLIRPQ++Q+++  EML NL RGD
Sbjct: 5   LIAPAFAQGAPVKGGG----MDTLIFMVLLFVMLYFLLIRPQQKQVKQHKEMLNNLNRGD 60

Query: 61  SIVTAAGIVGKVVRVID-DLELEVEIAE---------NVRVRVVRSFVSEVQSKSEP 107
            I+T+ G+V K+ R+ D + EL VEI E          VRVR+VR  V++V  KS P
Sbjct: 61  RILTSGGLVAKIHRIDDANDELVVEIGEVDIDGKNRKPVRVRLVRGNVAKVLDKSMP 117


>gi|29654450|ref|NP_820142.1| protein translocase subunit [Coxiella burnetii RSA 493]
 gi|29541717|gb|AAO90656.1| protein translocase subunit [Coxiella burnetii RSA 493]
          Length = 116

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 5   VYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVT 64
           VYA               M  L  +L +V+YFLLIRPQ ++ +   ++L  +  GD +VT
Sbjct: 12  VYAAPVTAQAPHPGGFWSMLWLPLLLILVFYFLLIRPQSKRAKEHRQLLEGISLGDEVVT 71

Query: 65  AAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             G+V +V R+  D  + +EI++   + V ++ ++ V  K  
Sbjct: 72  TGGVVARVSRLK-DNFVVLEISKGTEITVQKASIASVLPKGT 112


>gi|94498648|ref|ZP_01305200.1| preprotein translocase, YajC subunit [Sphingomonas sp. SKA58]
 gi|94421878|gb|EAT06927.1| preprotein translocase, YajC subunit [Sphingomonas sp. SKA58]
          Length = 111

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/101 (34%), Positives = 63/101 (62%), Gaps = 2/101 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +AQ+     + A   L       ++ VV+YFLLIRPQ+++++     +  +++GD 
Sbjct: 3   ITPAFAQTAGGQASGAG-ILVQMAPLVLIFVVFYFLLIRPQQKKMKAHKAKIDAVKKGDQ 61

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
           +VT  G+VGKVVRV DD+  +VE+A  ++V+ V++ +++V 
Sbjct: 62  VVTGGGLVGKVVRV-DDIYADVELAPGMKVKAVKATLTDVI 101


>gi|71281167|ref|YP_267864.1| preprotein translocase subunit YajC [Colwellia psychrerythraea 34H]
 gi|71146907|gb|AAZ27380.1| preprotein translocase, YajC subunit [Colwellia psychrerythraea
           34H]
          Length = 111

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
           +EM  +  V  +V++F++ RPQ ++++    ++ +L +GD ++T  GIVGK+V+V D+  
Sbjct: 21  MEMIIMLAVFGLVFFFMIYRPQAKRVKEHKGLMSSLGKGDEVLTQGGIVGKIVKVSDEKD 80

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + V I+E   V V +S ++ V  K  
Sbjct: 81  FIVVSISEGTEVTVQKSAINAVLPKGT 107


>gi|161830614|ref|YP_001597016.1| preprotein translocase, YajC subunit [Coxiella burnetii RSA 331]
 gi|161762481|gb|ABX78123.1| preprotein translocase, YajC subunit [Coxiella burnetii RSA 331]
          Length = 116

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 5   VYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVT 64
           VYA               M  L  +L +V+YFLLIRPQ ++ +   ++L  +  GD +VT
Sbjct: 12  VYAAPVTAQAPHPGGFWSMLWLPLLLILVFYFLLIRPQSKRAKEHRQLLEGISLGDEVVT 71

Query: 65  AAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             G+V +V R+  D  + +EI++   + V ++ ++ V  K  
Sbjct: 72  TGGVVARVSRLK-DNFVVLEISKGTEITVQKASIASVLPKGT 112


>gi|32034883|ref|ZP_00134982.1| COG1862: Preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208538|ref|YP_001053763.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae L20]
 gi|165976489|ref|YP_001652082.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190150393|ref|YP_001968918.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303250186|ref|ZP_07336388.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303253358|ref|ZP_07339507.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307245977|ref|ZP_07528059.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249164|ref|ZP_07531169.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250319|ref|ZP_07532269.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307252703|ref|ZP_07534594.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254955|ref|ZP_07536774.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307257111|ref|ZP_07538884.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307259393|ref|ZP_07541118.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307261548|ref|ZP_07543216.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307263737|ref|ZP_07545343.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|322513989|ref|ZP_08067064.1| preprotein translocase [Actinobacillus ureae ATCC 25976]
 gi|126097330|gb|ABN74158.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165876590|gb|ABY69638.1| preprotein translocase YajC subunit [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|189915524|gb|ACE61776.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302648040|gb|EFL78247.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302651249|gb|EFL81403.1| preprotein translocase subunit YajC [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306852912|gb|EFM85135.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854334|gb|EFM86532.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857646|gb|EFM89752.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859735|gb|EFM91757.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862073|gb|EFM94048.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306864382|gb|EFM96292.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306866329|gb|EFM98192.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306868671|gb|EFN00480.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306870858|gb|EFN02596.1| Protein translocase subunit yajC [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|322120215|gb|EFX92173.1| preprotein translocase [Actinobacillus ureae ATCC 25976]
          Length = 98

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 54/92 (58%), Gaps = 1/92 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                LEM  +  V  +++YF++ RPQ ++ +++ ++L NL +GD ++T  G++G++ +V
Sbjct: 2   QQGGGLEMIVILAVFGLIFYFMIYRPQAKRQKQQRDLLSNLAKGDEVLTNGGLIGRITKV 61

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             ++  + + + +   V + R++V  V  K +
Sbjct: 62  SAENENIVIALNDTTEVVISRNYVVAVLPKGQ 93


>gi|331005740|ref|ZP_08329101.1| Preprotein translocase subunit YajC [gamma proteobacterium
           IMCC1989]
 gi|330420457|gb|EGG94762.1| Preprotein translocase subunit YajC [gamma proteobacterium
           IMCC1989]
          Length = 111

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                     L   + ++ YF++IRPQR++ + +  ++  + +GD ++T  GI+GKV +V
Sbjct: 18  GLGGDFSGLLLIAGMFILMYFMIIRPQRKRQKEQQALVEGVAKGDEVLTTGGILGKVTKV 77

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +   + +E++ NV ++  +  +  V  K  
Sbjct: 78  -EGDYMVLEVSNNVELKFQKVSLHAVLPKGT 107


>gi|70732297|ref|YP_262053.1| preprotein translocase subunit YajC [Pseudomonas fluorescens Pf-5]
 gi|68346596|gb|AAY94202.1| preprotein translocase, YajC subunit, putative [Pseudomonas
           fluorescens Pf-5]
          Length = 112

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L +L++GD +VT  GI GK+ +V DD  + +E
Sbjct: 28  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLGSLQKGDEVVTTGGIAGKINKVTDDF-VVLE 86

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           ++++V ++  +  ++    K  
Sbjct: 87  VSDSVELKFQKGAIAATLPKGT 108


>gi|238783639|ref|ZP_04627660.1| hypothetical protein yberc0001_14220 [Yersinia bercovieri ATCC
           43970]
 gi|332160720|ref|YP_004297297.1| preprotein translocase subunit YajC [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|238715517|gb|EEQ07508.1| hypothetical protein yberc0001_14220 [Yersinia bercovieri ATCC
           43970]
 gi|318604597|emb|CBY26095.1| preprotein translocase subunit YajC [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664950|gb|ADZ41594.1| preprotein translocase subunit YajC [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 85

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 49/81 (60%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V +V +   + + +
Sbjct: 1   MLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDEVLTTGGLLGRVTKVAETGYIVIAL 60

Query: 86  AENVRVRVVRSFVSEVQSKSE 106
            +   V + R FV+ V  K  
Sbjct: 61  NDTTEVMIKRDFVAAVLPKGT 81


>gi|160896288|ref|YP_001561870.1| preprotein translocase subunit YajC [Delftia acidovorans SPH-1]
 gi|160361872|gb|ABX33485.1| preprotein translocase, YajC subunit [Delftia acidovorans SPH-1]
          Length = 111

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           +     S L       ++ VV YF++IRPQ ++ +    M+  L +GD + T+ GI+G+V
Sbjct: 17  SGGDFMSQLYGMAPLALMFVVLYFVMIRPQMKRQKEHRSMIEALAKGDEVATSGGIIGRV 76

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            R+ +   L +EIA  V V++ RS V +V  K  
Sbjct: 77  TRMSE-QFLHIEIASGVEVQIQRSAVVQVLPKDT 109


>gi|313623655|gb|EFR93811.1| preprotein translocase, YajC subunit [Listeria innocua FSL J1-023]
          Length = 110

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
               +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I
Sbjct: 1   MGGGIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAI 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +D  + ++   N ++   R+ +  V  K   V
Sbjct: 60  EDGTVILK-CGNSKLTFDRNAIRTVLEKGNAV 90


>gi|264680871|ref|YP_003280781.1| preprotein translocase, YajC subunit [Comamonas testosteroni CNB-2]
 gi|299531884|ref|ZP_07045284.1| preprotein translocase, YajC subunit [Comamonas testosteroni S44]
 gi|262211387|gb|ACY35485.1| preprotein translocase, YajC subunit [Comamonas testosteroni CNB-2]
 gi|298720059|gb|EFI61016.1| preprotein translocase, YajC subunit [Comamonas testosteroni S44]
          Length = 110

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                 L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA GI+G V R
Sbjct: 18  GGFMGSLTGMLPLVLMFVVLYFVMIRPQMKRQKEHRSMIDALAKGDEVATAGGIIGTVTR 77

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +   + +E+A  V V++ RS V +V  K  
Sbjct: 78  MAE-QFIYIEVASGVEVQIQRSAVVQVLPKGT 108


>gi|301063409|ref|ZP_07203945.1| preprotein translocase, YajC subunit [delta proteobacterium NaphS2]
 gi|300442482|gb|EFK06711.1| preprotein translocase, YajC subunit [delta proteobacterium NaphS2]
          Length = 106

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +  YA         A+          ++  ++YFLLIRPQ+++ ++  ++L  +++GD
Sbjct: 1   MISLAYAMGQQGGAEGASGGFGAFLPLILMFAIFYFLLIRPQQKKAKQHKQLLSAIKKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+ G V  + +D  + +EIA  VRV++ R  +S V +K++
Sbjct: 61  RVLTSGGLHGLVTGLTED-VVTIEIAPKVRVKIARGSISGVTTKAQ 105


>gi|238752763|ref|ZP_04614232.1| hypothetical protein yrohd0001_2500 [Yersinia rohdei ATCC 43380]
 gi|238760778|ref|ZP_04621889.1| hypothetical protein yaldo0001_37810 [Yersinia aldovae ATCC 35236]
 gi|238765177|ref|ZP_04626109.1| hypothetical protein ykris0001_45270 [Yersinia kristensenii ATCC
           33638]
 gi|238787975|ref|ZP_04631771.1| hypothetical protein yfred0001_14640 [Yersinia frederiksenii ATCC
           33641]
 gi|238791403|ref|ZP_04635041.1| hypothetical protein yinte0001_25540 [Yersinia intermedia ATCC
           29909]
 gi|238795570|ref|ZP_04639085.1| hypothetical protein ymoll0001_11610 [Yersinia mollaretii ATCC
           43969]
 gi|238696611|gb|EEP89396.1| hypothetical protein ykris0001_45270 [Yersinia kristensenii ATCC
           33638]
 gi|238701001|gb|EEP93607.1| hypothetical protein yaldo0001_37810 [Yersinia aldovae ATCC 35236]
 gi|238709021|gb|EEQ01270.1| hypothetical protein yrohd0001_2500 [Yersinia rohdei ATCC 43380]
 gi|238720689|gb|EEQ12490.1| hypothetical protein ymoll0001_11610 [Yersinia mollaretii ATCC
           43969]
 gi|238723923|gb|EEQ15567.1| hypothetical protein yfred0001_14640 [Yersinia frederiksenii ATCC
           33641]
 gi|238729019|gb|EEQ20535.1| hypothetical protein yinte0001_25540 [Yersinia intermedia ATCC
           29909]
          Length = 87

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 49/83 (59%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V +V +   + +
Sbjct: 1   MIMLVVFGLIFYFMILRPQQKRAKEHKKLMDSIGKGDEVLTTGGLLGRVTKVAETGYIVI 60

Query: 84  EIAENVRVRVVRSFVSEVQSKSE 106
            + +   V + R FV+ V  K  
Sbjct: 61  ALNDTTEVMIKRDFVAAVLPKGT 83


>gi|312134312|ref|YP_004001650.1| preprotein translocase, yajc subunit [Caldicellulosiruptor
           owensensis OL]
 gi|311774363|gb|ADQ03850.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           owensensis OL]
          Length = 122

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 6/113 (5%)

Query: 1   MFTTVYA------QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLR 54
           +F   YA      Q  APA  +A + L       ++ VV Y L+I PQR++ ++  EM+ 
Sbjct: 8   LFDIAYATNTQSSQQQAPAGATAIALLAQFIPLILMFVVLYLLIIVPQRKKEKQFREMIN 67

Query: 55  NLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +L  GD IVT AGI+GK+V + DD+      A+ V++R+ +  V E+  K+EP
Sbjct: 68  SLIVGDEIVTNAGIIGKIVNIKDDILTIEVGADRVKLRIYKWAVKEILKKAEP 120


>gi|16800632|ref|NP_470900.1| hypothetical protein lin1564 [Listeria innocua Clip11262]
 gi|16414051|emb|CAC96795.1| lin1564 [Listeria innocua Clip11262]
          Length = 110

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
               +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I
Sbjct: 1   MGGGIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAI 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +D  + ++   N ++   R+ +  V  K   V
Sbjct: 60  EDGTVILK-CGNSKLTFDRNAIRTVLEKGNTV 90


>gi|323519419|gb|ADX93800.1| preprotein translocase subunit YajC [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 109

 Score = 93.7 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
            +   L    +  V   ++YFL+ RPQ ++ +    ++ +L  G  +V A G++GKV + 
Sbjct: 16  QSPGLLPNILMIVVFVAIFYFLIWRPQAKRAKEHRSLIESLGVGSEVVFAGGLMGKVTK- 74

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +     VE+   V V++ R+ V  V  +  
Sbjct: 75  HEGDYAVVELNRGVEVKIQRASVISVLPEGT 105


>gi|15602093|ref|NP_245165.1| preprotein translocase subunit YajC [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|12720454|gb|AAK02312.1| YajC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 98

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               SP+ M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++ A G++G++ +
Sbjct: 3   AQQGSPMSMLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKGTEVLIAGGLIGRITK 62

Query: 75  VIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
           V  D   + + + E   V + R++V  V  K 
Sbjct: 63  VSPDSDSIIIALNETTEVTINRNYVVAVLPKG 94


>gi|150006309|ref|YP_001301053.1| hypothetical protein BVU_3820 [Bacteroides vulgatus ATCC 8482]
 gi|212691835|ref|ZP_03299963.1| hypothetical protein BACDOR_01330 [Bacteroides dorei DSM 17855]
 gi|237708041|ref|ZP_04538522.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237724808|ref|ZP_04555289.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|254885164|ref|ZP_05257874.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|265756190|ref|ZP_06090519.1| preprotein translocase, YajC subunit [Bacteroides sp. 3_1_33FAA]
 gi|294776294|ref|ZP_06741778.1| preprotein translocase, YajC subunit [Bacteroides vulgatus PC510]
 gi|319641351|ref|ZP_07996046.1| hypothetical protein HMPREF9011_01643 [Bacteroides sp. 3_1_40A]
 gi|149934733|gb|ABR41431.1| conserved hypothetical protein with conserved domain [Bacteroides
          vulgatus ATCC 8482]
 gi|212665591|gb|EEB26163.1| hypothetical protein BACDOR_01330 [Bacteroides dorei DSM 17855]
 gi|229437003|gb|EEO47080.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229457869|gb|EEO63590.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|254837957|gb|EET18266.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|263233781|gb|EEZ19390.1| preprotein translocase, YajC subunit [Bacteroides sp. 3_1_33FAA]
 gi|294449881|gb|EFG18397.1| preprotein translocase, YajC subunit [Bacteroides vulgatus PC510]
 gi|317387032|gb|EFV67916.1| hypothetical protein HMPREF9011_01643 [Bacteroides sp. 3_1_40A]
          Length = 104

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 14 ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
                      +   +  + YF +IRPQ ++ +  A   +NL  G  ++TA GI GK+ 
Sbjct: 9  QAGGGGDYSFLIMMVAIFAIMYFFMIRPQNKKQKEIANFRKNLEVGQEVITAGGIYGKIK 68

Query: 74 RVIDDLELEVEIAENVRVRVVRSFV 98
           + +D  + +EIA  V++++ R+ +
Sbjct: 69 EI-EDNTVVLEIASGVKIKIDRNSI 92


>gi|239906868|ref|YP_002953609.1| preprotein translocase YajC subunit [Desulfovibrio magneticus RS-1]
 gi|239796734|dbj|BAH75723.1| preprotein translocase YajC subunit [Desulfovibrio magneticus RS-1]
          Length = 123

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 53/81 (65%), Gaps = 1/81 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           +P+       ++  ++YFLLIRPQ+++ ++  E L  L+RGD I+T  GI G+++ V  D
Sbjct: 22  NPITAFLPLILMFAIFYFLLIRPQQKKAKQHREYLAGLKRGDYILTGGGIYGRIMEVHGD 81

Query: 79  LELEVEIAENVRVRVVRSFVS 99
             + +EIA+++ + + R+FVS
Sbjct: 82  K-ITIEIAKDLNIEINRNFVS 101


>gi|85860048|ref|YP_462250.1| protein translocase subunit [Syntrophus aciditrophicus SB]
 gi|85723139|gb|ABC78082.1| protein translocase subunit [Syntrophus aciditrophicus SB]
          Length = 112

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 54/85 (63%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +    +  V+  ++YFLLIRPQ+++ +   EML NL  GD ++T+ GI GK+  +  D  
Sbjct: 26  VSFLIMMAVIFCIFYFLLIRPQQKKQKELKEMLANLNHGDVVMTSGGIHGKIAALTGD-V 84

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
           + +E+A+ VRV+V R F++ V  K+
Sbjct: 85  VTLEVADKVRVKVSRGFIAAVLEKA 109


>gi|163731953|ref|ZP_02139400.1| preprotein translocase, YajC subunit, putative [Roseobacter
           litoralis Och 149]
 gi|161395407|gb|EDQ19729.1| preprotein translocase, YajC subunit, putative [Roseobacter
           litoralis Och 149]
          Length = 76

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 42/74 (56%), Positives = 58/74 (78%)

Query: 34  WYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRV 93
            YFLLIRPQ+++++    M+  LRRGD +VT  GI+GKVV+V DD ELE+EIAE V+VRV
Sbjct: 1   MYFLLIRPQQKKVKEHQAMVSALRRGDQVVTQGGILGKVVKVKDDGELELEIAEGVKVRV 60

Query: 94  VRSFVSEVQSKSEP 107
           ++S ++ V SK+EP
Sbjct: 61  IQSTIATVVSKTEP 74


>gi|153835757|ref|ZP_01988424.1| preprotein translocase, YajC subunit [Vibrio harveyi HY01]
 gi|156973360|ref|YP_001444267.1| preprotein translocase subunit YajC [Vibrio harveyi ATCC BAA-1116]
 gi|269962427|ref|ZP_06176777.1| preprotein translocase subunit YajC [Vibrio harveyi 1DA3]
 gi|148867571|gb|EDL66889.1| preprotein translocase, YajC subunit [Vibrio harveyi HY01]
 gi|156524954|gb|ABU70040.1| hypothetical protein VIBHAR_01047 [Vibrio harveyi ATCC BAA-1116]
 gi|269832923|gb|EEZ87032.1| preprotein translocase subunit YajC [Vibrio harveyi 1DA3]
          Length = 109

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
            EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T+ G+VGK+ ++ +D +
Sbjct: 19  FEMLIMLGMFAVIFYFMIYRPQSKRVKEHKNLMSSMGKGDEVLTSGGLVGKITKIAEDND 78

Query: 81  -LEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + FV+ V  K  
Sbjct: 79  FISIELNANNEVVIKKDFVTAVLPKGT 105


>gi|295688850|ref|YP_003592543.1| preprotein translocase subunit YajC [Caulobacter segnis ATCC 21756]
 gi|295430753|gb|ADG09925.1| preprotein translocase, YajC subunit [Caulobacter segnis ATCC
           21756]
          Length = 101

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 39/93 (41%), Positives = 66/93 (70%), Gaps = 1/93 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
            S  + +       ++ V++YF+LIRPQ+++ +    ML NL+RGDS+V ++G++GK+VR
Sbjct: 2   NSLNAQILQLAPILLMVVLFYFMLIRPQQKRAKEHQTMLANLKRGDSVVLSSGVLGKIVR 61

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           V +D E+ VEIA+ V V+VV+  ++EV++K EP
Sbjct: 62  V-EDKEVGVEIAQGVTVKVVKGMITEVRAKGEP 93


>gi|220935235|ref|YP_002514134.1| preprotein translocase, YajC subunit [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996545|gb|ACL73147.1| preprotein translocase, YajC subunit [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 109

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
            E   +  +   + YFL+IRPQ ++ +    M+ +L +GD +VT  G++G++V + ++  
Sbjct: 21  FEFLIMIAIFFAIMYFLIIRPQTKRAKEHRAMVESLSKGDEVVTGGGLLGRIVEL-EENF 79

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +E+A  V+V V R+ V+ V  K  
Sbjct: 80  IRIEVANGVQVTVQRTAVAAVMPKGT 105


>gi|238853830|ref|ZP_04644195.1| preprotein translocase subunit YajC [Lactobacillus gasseri 202-4]
 gi|311111126|ref|ZP_07712523.1| preprotein translocase, YajC subunit [Lactobacillus gasseri MV-22]
 gi|238833525|gb|EEQ25797.1| preprotein translocase subunit YajC [Lactobacillus gasseri 202-4]
 gi|311066280|gb|EFQ46620.1| preprotein translocase, YajC subunit [Lactobacillus gasseri MV-22]
          Length = 145

 Score = 93.7 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 5/103 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M T   AQS A       + + M      + V +YF +I+PQ++Q Q R +M+  L++GD
Sbjct: 1   MNTFFLAQSAA-----GMNNMFMIIAMIAIFVFFYFSMIKPQKKQQQERMKMMSELKKGD 55

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            ++   G+ GKV  + D  +  V  A+ + +   R  +  V  
Sbjct: 56  QVIMVDGLHGKVDSINDADKTVVIDADGIFLTFERMAIRRVLP 98


>gi|330950808|gb|EGH51068.1| preprotein translocase subunit YajC [Pseudomonas syringae Cit 7]
          Length = 111

 Score = 93.7 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L NL++GD +VT+ GI GK+ +V DD  + +E
Sbjct: 27  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLGNLQKGDEVVTSGGIAGKINKVTDDF-VVIE 85

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V +++ +  ++    K  
Sbjct: 86  VSDTVELKIQKGAIAATLPKGT 107


>gi|88858510|ref|ZP_01133152.1| putative preprotein translocase IISP family, membrane subunit
           [Pseudoalteromonas tunicata D2]
 gi|88820127|gb|EAR29940.1| putative preprotein translocase IISP family, membrane subunit
           [Pseudoalteromonas tunicata D2]
          Length = 111

 Score = 93.7 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
           +EM  +  +  +V+YFL+ RPQ ++++   +++  L +GD ++T+ G+VGK+ +V DD  
Sbjct: 21  MEMLIMLAIFGLVFYFLIYRPQAKRVKDHKDLMGALAKGDEVLTSGGLVGKISKVADDKD 80

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + + + +  +V V +  +S V  K  
Sbjct: 81  FVVIALNDQTQVTVQKGAISAVLPKGT 107


>gi|86145577|ref|ZP_01063907.1| preprotein translocase subunit YajC [Vibrio sp. MED222]
 gi|218708622|ref|YP_002416243.1| preprotein translocase subunit YajC [Vibrio splendidus LGP32]
 gi|85836548|gb|EAQ54674.1| preprotein translocase subunit YajC [Vibrio sp. MED222]
 gi|218321641|emb|CAV17593.1| Conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 109

 Score = 93.7 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
            EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T+ G++GK+ ++ +D  
Sbjct: 19  FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKSLMSSMGKGDEVLTSGGLIGKITKIAEDSD 78

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + FV+ V  K  
Sbjct: 79  YVAIELNANNEVVIKKDFVTAVLPKGT 105


>gi|303247264|ref|ZP_07333538.1| preprotein translocase, YajC subunit [Desulfovibrio fructosovorans
           JJ]
 gi|302491423|gb|EFL51311.1| preprotein translocase, YajC subunit [Desulfovibrio fructosovorans
           JJ]
          Length = 123

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 56/89 (62%), Gaps = 4/89 (4%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           +P+       ++  ++YFLLIRPQ+++ ++  E L NL+RGD I+T  GI G+++ V  D
Sbjct: 24  NPITAFLPLIIMFAIFYFLLIRPQQKKAKQHREYLANLKRGDYILTGGGIYGRIMEVHGD 83

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEP 107
             L VEIA+++ + + RSFVS      EP
Sbjct: 84  K-LTVEIAKDLTIEINRSFVSG---PGEP 108


>gi|297539526|ref|YP_003675295.1| preprotein translocase subunit YajC [Methylotenera sp. 301]
 gi|297258873|gb|ADI30718.1| preprotein translocase, YajC subunit [Methylotenera sp. 301]
          Length = 105

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 6/105 (5%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +  YA     A  +    L       V+ V+++F++IRPQ +  + + EM+  L++GD 
Sbjct: 3   ISNAYA-----AGATTGGDLMSFLPLVVIFVLFFFMIIRPQMKAAKAQREMITALQKGDE 57

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT+ GIVGKV +V +   + +EIA N+ + V +  V     K  
Sbjct: 58  VVTSGGIVGKVTKVTE-SFVSLEIAANIEITVQKQAVQSALPKGT 101


>gi|52425617|ref|YP_088754.1| preprotein translocase subunit YajC [Mannheimia succiniciproducens
           MBEL55E]
 gi|52307669|gb|AAU38169.1| YajC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 99

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               SP+ M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++T+ G+VGK+ +
Sbjct: 3   AQQGSPMSMLIIFAIFGLIFYFMIYRPQAKRNKEHRQLMSQLAKGTEVLTSGGLVGKITK 62

Query: 75  VI-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +  D   + + + E   V + R F+  V  K 
Sbjct: 63  ITADSDMVVIALNETNEVTIKRDFIVAVLPKG 94


>gi|148981304|ref|ZP_01816364.1| preprotein translocase subunit YajC [Vibrionales bacterium SWAT-3]
 gi|145960936|gb|EDK26264.1| preprotein translocase subunit YajC [Vibrionales bacterium SWAT-3]
          Length = 109

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
            EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T+ G++GK+ ++ +D  
Sbjct: 19  FEMLIMLGMFAVIFYFMIYRPQAKRVKEHKNLMASMGKGDEVLTSGGLIGKITKIAEDSD 78

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + FV+ V  K  
Sbjct: 79  YVAIELNANNEVVIKKDFVTAVLPKGT 105


>gi|313894621|ref|ZP_07828184.1| preprotein translocase, YajC subunit [Veillonella sp. oral taxon
           158 str. F0412]
 gi|313440811|gb|EFR59240.1| preprotein translocase, YajC subunit [Veillonella sp. oral taxon
           158 str. F0412]
          Length = 96

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 57/84 (67%), Gaps = 1/84 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L+ +    ++ V++YFLL RPQ++Q + RA +L +L++G  IVT  GI G++V + DD +
Sbjct: 8   LQTSWPILLMVVIFYFLLWRPQKKQQKERANLLGSLKKGQKIVTIGGIYGEIVEL-DDEK 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSK 104
           ++V+++E V +   R+ V+ V SK
Sbjct: 67  VKVQVSEKVELTFARTAVANVLSK 90


>gi|296535917|ref|ZP_06898070.1| preprotein translocase [Roseomonas cervicalis ATCC 49957]
 gi|296263756|gb|EFH10228.1| preprotein translocase [Roseomonas cervicalis ATCC 49957]
          Length = 113

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/85 (43%), Positives = 55/85 (64%), Gaps = 1/85 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD- 78
            +       ++ VV+YFLLIRPQ+++ +    ML  L+R D +VTA GI+G V +V ++ 
Sbjct: 18  MVMQLAPLILIFVVFYFLLIRPQQKRAKEHRLMLGALKRNDRVVTAGGILGTVTKVKENS 77

Query: 79  LELEVEIAENVRVRVVRSFVSEVQS 103
            E+E+EIA NVRV VVRS +S +  
Sbjct: 78  EEVELEIAPNVRVTVVRSTISTLLK 102


>gi|332285321|ref|YP_004417232.1| putative secreted protein [Pusillimonas sp. T7-7]
 gi|330429274|gb|AEC20608.1| putative secreted protein [Pusillimonas sp. T7-7]
          Length = 114

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 51/101 (50%), Gaps = 5/101 (4%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            A A     + L       ++ V+ YFL+IRPQ ++ +    M+  L +GD ++T  G++
Sbjct: 11  TAQAAAGGENALMGMLPIILMFVILYFLMIRPQMKRQKEHRNMVAALAKGDEVITTGGLL 70

Query: 70  GKVVRVIDDLELEVEIA----ENVRVRVVRSFVSEVQSKSE 106
           GKV +V  D  + VEI+    + V   V R+ V+ +  K  
Sbjct: 71  GKVTKVS-DSYITVEISMVGDKPVETVVQRTAVTSILPKGT 110


>gi|310766811|gb|ADP11761.1| preprotein translocase subunit YajC [Erwinia sp. Ejp617]
          Length = 85

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 49/81 (60%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+VG+V +V +   + + +
Sbjct: 1   MLVVFGLIFYFMILRPQQKRAKEHKKLMDSIAKGDEVLTTGGLVGRVTKVAETGYVAIAL 60

Query: 86  AENVRVRVVRSFVSEVQSKSE 106
            +   V V R FV+ V  K  
Sbjct: 61  NDTTEVVVKRDFVAAVLPKGT 81


>gi|295695633|ref|YP_003588871.1| preprotein translocase, YajC subunit [Bacillus tusciae DSM 2912]
 gi|295411235|gb|ADG05727.1| preprotein translocase, YajC subunit [Bacillus tusciae DSM 2912]
          Length = 89

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   V+  ++YFLLIRPQ+++ + R  ML  L++GD +VT  GI G VV + DD  
Sbjct: 6   YSGILSIIVMFAIFYFLLIRPQQKRQKERQAMLSKLQKGDKVVTIGGIHGTVVDLTDDQ- 64

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
           + + +AE  ++   RS +S V   S
Sbjct: 65  VTLRVAETTKIVFERSAISSVIKDS 89


>gi|163783708|ref|ZP_02178695.1| elongation factor Ts [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881033|gb|EDP74550.1| elongation factor Ts [Hydrogenivirga sp. 128-5-R1-1]
          Length = 112

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M    +AQ      +   + L        +  ++YFL+IRPQ+++ +R  +++ +L++GD
Sbjct: 1  MIDIAFAQGQGHQ-SPTGAILFQVLFLVGIFAIFYFLIIRPQKKERERHRKLIESLKKGD 59

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           ++T+AGI G VV V  D  + +++  N R+   +  +
Sbjct: 60 KVITSAGIWGTVVEV-GDRTVSLKVDANTRITFSKEAI 96


>gi|302389931|ref|YP_003825752.1| protein translocase subunit yajC [Thermosediminibacter oceani DSM
           16646]
 gi|302200559|gb|ADL08129.1| protein translocase subunit yajC [Thermosediminibacter oceani DSM
           16646]
          Length = 94

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 56/87 (64%), Gaps = 1/87 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            L+  G   ++  ++YF++IRPQ+++ + R  ML +L+ GD I+T  GI G+++ + DD 
Sbjct: 6   FLQQFGPIILIFAIFYFMIIRPQQKREKERRNMLDSLKEGDEIITIGGIFGRILNIKDD- 64

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+ + V+++V RS +  V  ++E
Sbjct: 65  VVTLEVGDKVKIKVTRSAIGNVIKRAE 91


>gi|296134582|ref|YP_003641824.1| preprotein translocase, YajC subunit [Thiomonas intermedia K12]
 gi|294338528|emb|CAZ86857.1| Preprotein translocase subunit YajC [Thiomonas sp. 3As]
 gi|295794704|gb|ADG29494.1| preprotein translocase, YajC subunit [Thiomonas intermedia K12]
          Length = 111

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            S L       V+ V+ YF+++RPQ ++ +    ML  L +GD +VT  G+VGK+ ++ +
Sbjct: 19  GSTLMSLLPIIVMFVILYFVMLRPQMKKQKELRAMLAALAKGDEVVTTGGVVGKISKI-N 77

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + +EIA N  V + RS V+ V  K  
Sbjct: 78  DNYVTLEIAANTEVLLQRSAVTMVLPKGT 106


>gi|330869597|gb|EGH04306.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 108

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L NL++GD +VT+ GI GK+ +V DD  + +E
Sbjct: 24  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLGNLQKGDEVVTSGGIAGKINKVTDDF-VVIE 82

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V +++ +  ++    K  
Sbjct: 83  VSDTVELKIQKGAIAATLPKGT 104


>gi|114797763|ref|YP_760628.1| preprotein translocase, YajC subunit [Hyphomonas neptunium ATCC
           15444]
 gi|114737937|gb|ABI76062.1| preprotein translocase, YajC subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 124

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/89 (46%), Positives = 67/89 (75%), Gaps = 1/89 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +F  L +++YFLLIRPQ+Q+ ++   M+  ++RGD++VT+ G++GKV +V  D 
Sbjct: 33  LMMQLVMFLPLILIFYFLLIRPQQQRAKKHTAMISAIKRGDTVVTSGGLIGKVNKVS-DT 91

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           E+ V++AENVRVRV++S V EV++K+EPV
Sbjct: 92  EISVDLAENVRVRVIKSMVIEVRNKAEPV 120


>gi|257094091|ref|YP_003167732.1| preprotein translocase subunit YajC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257046615|gb|ACV35803.1| preprotein translocase, YajC subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 108

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           T          ++ VV YFL+IRPQ ++ +    ++  L +GD +VT  GI G+V RV  
Sbjct: 17  TGGFMQLLPIILMFVVLYFLMIRPQMKRAKEHKALIEGLAKGDEVVTGGGIAGRVTRVS- 75

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + ++IAE V + V +  V+ V  K  
Sbjct: 76  DSFIALQIAEAVEIHVQKQAVTLVLPKGT 104


>gi|238650646|ref|YP_002916498.1| preprotein translocase subunit YajC [Rickettsia peacockii str.
           Rustic]
 gi|238624744|gb|ACR47450.1| preprotein translocase subunit YajC [Rickettsia peacockii str.
           Rustic]
          Length = 141

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 62/99 (62%), Gaps = 1/99 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
                S  S L       ++  V+YFLL+RPQ  + + R +++  +++G+ ++T +GI G
Sbjct: 25  PAETNSLQSGLTSLIPMVLIFAVFYFLLLRPQETRRKEREKLVSEVKKGEEVLTNSGIYG 84

Query: 71  KVVRVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            V +V + D  +E+EIA++VR++V++S + ++ S+++ V
Sbjct: 85  IVTKVSENDNNIEIEIAKDVRIKVLKSAIIDITSRTKAV 123


>gi|315127833|ref|YP_004069836.1| preprotein translocase subunit YajC [Pseudoalteromonas sp. SM9913]
 gi|315016347|gb|ADT69685.1| preprotein translocase subunit YajC [Pseudoalteromonas sp. SM9913]
          Length = 111

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
           +EM  +  +  +V+YFL+ RPQ ++++    ++  + +GD ++T  G+VGK+V++ +D  
Sbjct: 21  MEMLIMLAIFGLVFYFLIYRPQAKRVKEHKSLMSAMAKGDEVLTQGGLVGKIVKIAEDKD 80

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + + + E   V V +S VS V  K  
Sbjct: 81  FIVISLNEQAEVTVQKSAVSAVLPKGT 107


>gi|312880423|ref|ZP_07740223.1| protein translocase subunit yajC [Aminomonas paucivorans DSM
          12260]
 gi|310783714|gb|EFQ24112.1| protein translocase subunit yajC [Aminomonas paucivorans DSM
          12260]
          Length = 126

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                  + M     +  V++YFL++RPQ+++ +   +ML ++ RGD++VTA G  G V
Sbjct: 2  GNAQQGGIMGMLLPLALFVVIFYFLIVRPQKKKQKAHDQMLASIGRGDTVVTAGGFFGVV 61

Query: 73 VRVIDDLELEVEIAENVRVRVVRSFVS 99
            ++DD  + +E+AE V++R+++  +S
Sbjct: 62 RELLDDSYI-IEVAEGVKMRILKGSIS 87


>gi|313618790|gb|EFR90686.1| preprotein translocase, YajC subunit [Listeria innocua FSL S4-378]
          Length = 110

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
               +       ++ +++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I
Sbjct: 1   MGGGIVTFIPIILMIILFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAI 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +D  + ++   N ++   R+ +  V  K   V
Sbjct: 60  EDGTVILK-CGNSKLTFDRNAIRTVLEKGNTV 90


>gi|169632426|ref|YP_001706162.1| putative SecYEG protein translocase auxillary subunit (YajC)
           [Acinetobacter baumannii SDF]
 gi|169794705|ref|YP_001712498.1| putative SecYEG protein translocase auxillary subunit (YajC)
           [Acinetobacter baumannii AYE]
 gi|184159485|ref|YP_001847824.1| preprotein translocase subunit YajC [Acinetobacter baumannii ACICU]
 gi|213157924|ref|YP_002320722.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           AB0057]
 gi|215482292|ref|YP_002324474.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           AB307-0294]
 gi|239501676|ref|ZP_04660986.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           AB900]
 gi|260548782|ref|ZP_05823004.1| preprotein translocase subunit YajC [Acinetobacter sp. RUH2624]
 gi|260557110|ref|ZP_05829326.1| preprotein translocase subunit [Acinetobacter baumannii ATCC 19606]
 gi|301347238|ref|ZP_07227979.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           AB056]
 gi|301511796|ref|ZP_07237033.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           AB058]
 gi|301595290|ref|ZP_07240298.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           AB059]
 gi|332852198|ref|ZP_08434003.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           6013150]
 gi|332868166|ref|ZP_08438045.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           6013113]
 gi|332873840|ref|ZP_08441781.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           6014059]
 gi|169147632|emb|CAM85495.1| putative SecYEG protein translocase auxillary subunit (YajC)
           [Acinetobacter baumannii AYE]
 gi|169151218|emb|CAO99901.1| putative SecYEG protein translocase auxillary subunit (YajC)
           [Acinetobacter baumannii]
 gi|183211079|gb|ACC58477.1| Preprotein translocase subunit YajC [Acinetobacter baumannii ACICU]
 gi|193078347|gb|ABO13318.2| putative preprotein translocase IISP family membrane subunit
           [Acinetobacter baumannii ATCC 17978]
 gi|213057084|gb|ACJ41986.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           AB0057]
 gi|213985937|gb|ACJ56236.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           AB307-0294]
 gi|260407950|gb|EEX01421.1| preprotein translocase subunit YajC [Acinetobacter sp. RUH2624]
 gi|260409216|gb|EEX02518.1| preprotein translocase subunit [Acinetobacter baumannii ATCC 19606]
 gi|322509398|gb|ADX04852.1| preprotein translocase subunit YajC [Acinetobacter baumannii
           1656-2]
 gi|332729328|gb|EGJ60668.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           6013150]
 gi|332733510|gb|EGJ64678.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           6013113]
 gi|332737944|gb|EGJ68830.1| preprotein translocase, YajC subunit [Acinetobacter baumannii
           6014059]
          Length = 109

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
            +   L    +  V   ++YFL+ RPQ ++ +    ++ +L  G  +V A G++GKV ++
Sbjct: 16  QSPGLLPNILMIVVFVAIFYFLIWRPQAKRAKEHRSLIESLGVGSEVVFAGGLMGKVTKL 75

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D  + VE+   V V++ R+ V  V  +  
Sbjct: 76  EGDYAV-VELNRGVEVKIQRASVISVLPEGT 105


>gi|289434809|ref|YP_003464681.1| preprotein translocase, YajC-type subunit [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
 gi|289171053|emb|CBH27595.1| preprotein translocase, YajC-type subunit [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
          Length = 109

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I+
Sbjct: 1   MGGIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D  + ++   N ++   R+ V  V  K   V
Sbjct: 60  DGTVILKCGNN-KLTFDRNAVRTVLEKGNAV 89


>gi|329850433|ref|ZP_08265278.1| preprotein translocase, YajC subunit [Asticcacaulis biprosthecum
           C19]
 gi|328840748|gb|EGF90319.1| preprotein translocase, YajC subunit [Asticcacaulis biprosthecum
           C19]
          Length = 117

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 60/94 (63%), Gaps = 1/94 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
            +     L M  +      + YF +IRPQ+Q+ ++   M+  ++R D++V ++G++GKV 
Sbjct: 16  PSGTDGLLSMLPMLIGFIAIMYFFMIRPQQQRAKQHKAMISAIKRNDTVVLSSGLIGKVT 75

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           RV +D E+ +E+A  V VRVV++ ++EV++K EP
Sbjct: 76  RV-EDAEISMEVASGVNVRVVKAMITEVRAKGEP 108


>gi|319796464|ref|YP_004158104.1| preprotein translocase, yajc subunit [Variovorax paradoxus EPS]
 gi|315598927|gb|ADU39993.1| preprotein translocase, YajC subunit [Variovorax paradoxus EPS]
          Length = 110

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                 S L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA G++GK+
Sbjct: 16  GGGDMLSSLGSMLPLVLMFVVLYFVMIRPQMKRQKEARAMIEALAKGDEVATAGGVLGKI 75

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
             +  D  L +EIA  + +++ RS V +V  K 
Sbjct: 76  TSL-GDQYLGLEIANGIEIKIQRSAVVQVLPKG 107


>gi|253999938|ref|YP_003052001.1| preprotein translocase subunit YajC [Methylovorus sp. SIP3-4]
 gi|313201912|ref|YP_004040570.1| preprotein translocase subunit YajC [Methylovorus sp. MP688]
 gi|253986617|gb|ACT51474.1| preprotein translocase, YajC subunit [Methylovorus sp. SIP3-4]
 gi|312441228|gb|ADQ85334.1| preprotein translocase, YajC subunit [Methylovorus sp. MP688]
          Length = 105

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   V+ V+++F+LIRPQ +Q + +  ML  L++GD ++TA GIVGKV +V  D  
Sbjct: 17  WTSFLPLVVIFVLFWFMLIRPQMKQAKEQRRMLEALQKGDEVITAGGIVGKVTKV-GDAY 75

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +EIA  V + V +  V  +  K  
Sbjct: 76  VTIEIAPEVNINVQKQTVQTLLPKGT 101


>gi|16803569|ref|NP_465054.1| hypothetical protein lmo1529 [Listeria monocytogenes EGD-e]
 gi|46907757|ref|YP_014146.1| preprotein translocase subunit YajC [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47094200|ref|ZP_00231915.1| preprotein translocase, YajC subunit [Listeria monocytogenes str.
           4b H7858]
 gi|47097026|ref|ZP_00234599.1| preprotein translocase, YajC subunit [Listeria monocytogenes str.
           1/2a F6854]
 gi|224499810|ref|ZP_03668159.1| preprotein translocase, YajC subunit [Listeria monocytogenes
           Finland 1988]
 gi|224501531|ref|ZP_03669838.1| preprotein translocase, YajC subunit [Listeria monocytogenes FSL
           R2-561]
 gi|226224130|ref|YP_002758237.1| hypothetical protein Lm4b_01539 [Listeria monocytogenes Clip81459]
 gi|254824412|ref|ZP_05229413.1| preprotein translocase [Listeria monocytogenes FSL J1-194]
 gi|254828237|ref|ZP_05232924.1| preprotein translocase [Listeria monocytogenes FSL N3-165]
 gi|254829712|ref|ZP_05234367.1| hypothetical protein Lmon1_00085 [Listeria monocytogenes 10403S]
 gi|254852153|ref|ZP_05241501.1| preprotein translocase [Listeria monocytogenes FSL R2-503]
 gi|254898305|ref|ZP_05258229.1| hypothetical protein LmonJ_00780 [Listeria monocytogenes J0161]
 gi|254912203|ref|ZP_05262215.1| preprotein translocase [Listeria monocytogenes J2818]
 gi|254931464|ref|ZP_05264823.1| preprotein translocase [Listeria monocytogenes HPB2262]
 gi|254936531|ref|ZP_05268228.1| preprotein translocase [Listeria monocytogenes F6900]
 gi|254993587|ref|ZP_05275777.1| hypothetical protein LmonocytoFSL_11768 [Listeria monocytogenes FSL
           J2-064]
 gi|255030835|ref|ZP_05302786.1| hypothetical protein LmonL_20096 [Listeria monocytogenes LO28]
 gi|255520697|ref|ZP_05387934.1| hypothetical protein LmonocFSL_05641 [Listeria monocytogenes FSL
           J1-175]
 gi|284801919|ref|YP_003413784.1| hypothetical protein LM5578_1674 [Listeria monocytogenes 08-5578]
 gi|284995061|ref|YP_003416829.1| hypothetical protein LM5923_1626 [Listeria monocytogenes 08-5923]
 gi|300764804|ref|ZP_07074794.1| preprotein translocase, YajC subunit [Listeria monocytogenes FSL
           N1-017]
 gi|16410958|emb|CAC99607.1| lmo1529 [Listeria monocytogenes EGD-e]
 gi|46881026|gb|AAT04323.1| preprotein translocase, YajC subunit [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47014608|gb|EAL05568.1| preprotein translocase, YajC subunit [Listeria monocytogenes str.
           1/2a F6854]
 gi|47017427|gb|EAL08245.1| preprotein translocase, YajC subunit [Listeria monocytogenes str.
           4b H7858]
 gi|225876592|emb|CAS05301.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258600625|gb|EEW13950.1| preprotein translocase [Listeria monocytogenes FSL N3-165]
 gi|258605456|gb|EEW18064.1| preprotein translocase [Listeria monocytogenes FSL R2-503]
 gi|258609125|gb|EEW21733.1| preprotein translocase [Listeria monocytogenes F6900]
 gi|284057481|gb|ADB68422.1| hypothetical protein LM5578_1674 [Listeria monocytogenes 08-5578]
 gi|284060528|gb|ADB71467.1| hypothetical protein LM5923_1626 [Listeria monocytogenes 08-5923]
 gi|293583016|gb|EFF95048.1| preprotein translocase [Listeria monocytogenes HPB2262]
 gi|293590176|gb|EFF98510.1| preprotein translocase [Listeria monocytogenes J2818]
 gi|293593647|gb|EFG01408.1| preprotein translocase [Listeria monocytogenes FSL J1-194]
 gi|300514480|gb|EFK41537.1| preprotein translocase, YajC subunit [Listeria monocytogenes FSL
           N1-017]
 gi|328465566|gb|EGF36795.1| preprotein translocase, YajC subunit [Listeria monocytogenes 1816]
 gi|328474889|gb|EGF45689.1| preprotein translocase, YajC subunit [Listeria monocytogenes 220]
 gi|332311971|gb|EGJ25066.1| Preprotein translocase subunit YajC [Listeria monocytogenes str.
           Scott A]
          Length = 109

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I+
Sbjct: 1   MGGIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D  + ++   N ++   R+ +  V  K   V
Sbjct: 60  DGTVILK-CGNSKLTFDRNAIRTVLEKGNAV 89


>gi|46202959|ref|ZP_00052319.2| COG1862: Preprotein translocase subunit YajC [Magnetospirillum
           magnetotacticum MS-1]
          Length = 110

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/87 (52%), Positives = 65/87 (74%), Gaps = 1/87 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-LEL 81
               F ++ V+ YFL++RPQ+++L+    M++NLRR D+IVT  G+VG+VV+V DD  E+
Sbjct: 21  QFVPFVLIFVIMYFLILRPQQRRLKDHQSMVKNLRREDTIVTNGGLVGRVVKVADDASEV 80

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEPV 108
           EVEIA NVRV+VVRS +SEV+ K  PV
Sbjct: 81  EVEIAPNVRVKVVRSMISEVRVKGGPV 107


>gi|315282445|ref|ZP_07870857.1| preprotein translocase, YajC subunit [Listeria marthii FSL S4-120]
 gi|313613908|gb|EFR87640.1| preprotein translocase, YajC subunit [Listeria marthii FSL S4-120]
          Length = 106

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I+
Sbjct: 1   MGSIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + ++   N ++   R+ V  V  K  
Sbjct: 60  DGTVILK-CGNSKLTFDRNAVRTVLEKGT 87


>gi|157828751|ref|YP_001494993.1| preprotein translocase subunit YajC [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165933478|ref|YP_001650267.1| preprotein translocase subunit YajC [Rickettsia rickettsii str.
           Iowa]
 gi|157801232|gb|ABV76485.1| preprotein translocase subunit YajC [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165908565|gb|ABY72861.1| protein translocase subunit [Rickettsia rickettsii str. Iowa]
          Length = 141

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 62/99 (62%), Gaps = 1/99 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
                S  S L       ++  V+YFLL+RPQ  + + R +++  +++G+ ++T +GI G
Sbjct: 25  PAETNSLQSGLTSLIPMVLIFAVFYFLLLRPQETRRKEREKLVSEVKKGEEVLTNSGIYG 84

Query: 71  KVVRVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            V +V + D  +E+EIA++VR++V++S + ++ S+++ V
Sbjct: 85  IVTKVSENDNNIEIEIAKDVRIKVLKSAIIDITSRTKEV 123


>gi|258593145|emb|CBE69456.1| preprotein translocase (YajC) [NC10 bacterium 'Dutch sediment']
          Length = 113

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 61/97 (62%)

Query: 4   TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
             +AQ   PA    TS L +     ++ +V+YFL+IRPQ+++ + + +ML NL+ GD I+
Sbjct: 3   IAWAQQGTPAEAGPTSILPVMLPSVLIFLVFYFLMIRPQQKKQKEQKDMLANLKTGDQII 62

Query: 64  TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           T  G+ G +V+  +D  ++V IAENV V + RS ++E
Sbjct: 63  TTGGLYGTIVKFGEDNRVKVRIAENVTVEIARSAITE 99


>gi|319778541|ref|YP_004129454.1| Preprotein translocase subunit YajC [Taylorella equigenitalis MCE9]
 gi|317108565|gb|ADU91311.1| Preprotein translocase subunit YajC [Taylorella equigenitalis MCE9]
          Length = 119

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 4/103 (3%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A + A    S    +       ++  V +FLL+RPQ ++ +   +M+  L  G+ ++T  
Sbjct: 14  ATAPAATNQSLAGTITGLLPMILMFGVLWFLLVRPQMKRQKEHRKMVETLAVGNEVITTG 73

Query: 67  GIVGKVVRVIDDLELEVEIAEN---VRVRVVRSFVSEVQSKSE 106
           GI+GK+  +  D  + ++I+++   V + + R  ++ V  K  
Sbjct: 74  GILGKITHLT-DNYITLDISKSDQVVEILLQRVAIAAVLPKGT 115


>gi|91203069|emb|CAJ72708.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 133

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
             A       + +   F ++ VV YFL++RPQ+++ + R  +L  +R+ D ++TA GI G
Sbjct: 6   QAAGKGPGGMMSLLLPFILMFVVMYFLILRPQKRKEKERKALLSRIRKSDRVITAGGIHG 65

Query: 71  KVVRVIDDLELE-VEIAENVRVRVVRSFVSEVQ 102
            V  V +   +  ++ +++V+V+V RS ++ V 
Sbjct: 66  VVTSVRETEVVIRIDESKDVKVKVDRSSIATVL 98


>gi|293611109|ref|ZP_06693408.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826761|gb|EFF85127.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325123437|gb|ADY82960.1| putative preprotein translocase IISP family, membrane subunit
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 109

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                 L    +  V   ++YFL+ RPQ ++ +    ++ +L  G  +V A G++GKV +
Sbjct: 15  GPTNGILPNILMIVVFVAIFYFLIWRPQAKRAKEHRSLIESLGVGSEVVFAGGLMGKVTK 74

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +  D  + VE++  V V++ R+ V  V  +  
Sbjct: 75  IEGDYAV-VELSRGVEVKIQRASVISVLPEGT 105


>gi|91774868|ref|YP_544624.1| protein translocase subunit yajC [Methylobacillus flagellatus KT]
 gi|91708855|gb|ABE48783.1| protein translocase subunit yajC [Methylobacillus flagellatus KT]
          Length = 106

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   ++  +++F+LIRPQ +Q + + +++  L++GD + T++GIVG++ +V +   
Sbjct: 18  WMSFLPLIIIFALFWFMLIRPQMKQAKEQRKLIEALQKGDEVTTSSGIVGRITKVGEG-Y 76

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +EIA    + V +  V  +  K  
Sbjct: 77  VSLEIAPETVITVQKHTVQTLLPKGT 102


>gi|24213841|ref|NP_711322.1| preprotein translocase subunit YajC [Leptospira interrogans
          serovar Lai str. 56601]
 gi|45658382|ref|YP_002468.1| hypothetical protein LIC12540 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
 gi|24194679|gb|AAN48340.1| Preprotein translocase YajC subunit [Leptospira interrogans
          serovar Lai str. 56601]
 gi|45601625|gb|AAS71105.1| YajC [Leptospira interrogans serovar Copenhageni str. Fiocruz
          L1-130]
          Length = 108

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 1/99 (1%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M   +  Q    A     SP     L  ++ V+ YFL+IRPQR + ++R EM+ +L++GD
Sbjct: 1  MTFDILLQLAQAAGEGDKSPFSTLLLIPIMLVIMYFLVIRPQRNEEKKRKEMIDSLKKGD 60

Query: 61 SIVTAAGIVGKVVRVIDDLELEVE-IAENVRVRVVRSFV 98
           +VT++GI GKVV + D+ E+ V  IA++  V    S V
Sbjct: 61 EVVTSSGIHGKVVEIKDNNEVVVLNIAKDTNVSFTASTV 99


>gi|313633146|gb|EFS00034.1| preprotein translocase, YajC subunit [Listeria seeligeri FSL
           N1-067]
          Length = 105

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
                  ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I+D  +
Sbjct: 1   VTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAIEDGTV 59

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEPV 108
            ++   N ++   R+ V  V  K + V
Sbjct: 60  ILKCGNN-KLTFDRNAVRTVLEKGDAV 85


>gi|28868621|ref|NP_791240.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|66044477|ref|YP_234318.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           syringae B728a]
 gi|71737790|ref|YP_273559.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213971537|ref|ZP_03399648.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           tomato T1]
 gi|257487218|ref|ZP_05641259.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289626172|ref|ZP_06459126.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649079|ref|ZP_06480422.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289677973|ref|ZP_06498863.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           syringae FF5]
 gi|298486005|ref|ZP_07004079.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301386142|ref|ZP_07234560.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060704|ref|ZP_07252245.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           tomato K40]
 gi|302135101|ref|ZP_07261091.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|302185764|ref|ZP_07262437.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           syringae 642]
 gi|28851859|gb|AAO54935.1| preprotein translocase, YajC subunit [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|51102890|gb|AAT96040.1| YajC [Pseudomonas viridiflava]
 gi|51102919|gb|AAT96068.1| YajC [Pseudomonas viridiflava]
 gi|51102956|gb|AAT96104.1| YajC [Pseudomonas viridiflava]
 gi|51102973|gb|AAT96120.1| YajC [Pseudomonas viridiflava]
 gi|51103034|gb|AAT96180.1| YajC [Pseudomonas viridiflava]
 gi|63255184|gb|AAY36280.1| YajC [Pseudomonas syringae pv. syringae B728a]
 gi|71558343|gb|AAZ37554.1| preprotein translocase, YajC subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213923729|gb|EEB57313.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           tomato T1]
 gi|298159482|gb|EFI00529.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322940|gb|EFW79030.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329937|gb|EFW85925.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330872899|gb|EGH07048.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330874651|gb|EGH08800.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330894476|gb|EGH27137.1| preprotein translocase subunit YajC [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330895869|gb|EGH28155.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330957507|gb|EGH57767.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330965896|gb|EGH66156.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|330969088|gb|EGH69154.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330984995|gb|EGH83098.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009167|gb|EGH89223.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331019399|gb|EGH99455.1| preprotein translocase subunit YajC [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 111

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L NL++GD +VT+ GI GK+ +V DD  + +E
Sbjct: 27  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLGNLQKGDEVVTSGGIAGKINKVTDDF-VVIE 85

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V +++ +  ++    K  
Sbjct: 86  VSDTVELKIQKGAIAATLPKGT 107


>gi|89902626|ref|YP_525097.1| preprotein translocase subunit YajC [Rhodoferax ferrireducens T118]
 gi|89347363|gb|ABD71566.1| protein translocase subunit yajC [Rhodoferax ferrireducens T118]
          Length = 91

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++ VV YF++IRPQ ++ +    M+  L +GD + T  G++GKV ++ + 
Sbjct: 3   SSLMSMLPLVLMFVVLYFVMIRPQMKKQKEHRAMIEALAKGDEVATVGGMLGKVSKLGEG 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKS 105
             L +E+A NV V++ RS V  V  K 
Sbjct: 63  -YLTLEVAPNVEVQIQRSAVVLVLPKG 88


>gi|67459350|ref|YP_246974.1| preprotein translocase subunit YajC [Rickettsia felis URRWXCal2]
 gi|67004883|gb|AAY61809.1| Preprotein translocase YajC subunit [Rickettsia felis URRWXCal2]
          Length = 167

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+YFLL+RPQ ++ + R +++  +++G+ ++T +GI G V 
Sbjct: 53  TNSLQSGLTSLTPMVLIFAVFYFLLLRPQEKRRKEREKLVSEVKKGEEVLTNSGIYGIVT 112

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V + D  +E+EIA++VR++ ++S + ++ S+++ V
Sbjct: 113 KVSENDNNIEIEIAKDVRIKALKSAIVDITSRTKEV 148


>gi|15892816|ref|NP_360530.1| preprotein translocase subunit YajC [Rickettsia conorii str. Malish
           7]
 gi|34581476|ref|ZP_00142956.1| hypothetical protein [Rickettsia sibirica 246]
 gi|81528060|sp|Q92H78|Y893_RICCN RecName: Full=UPF0092 membrane protein RC0893
 gi|15619999|gb|AAL03431.1| unknown [Rickettsia conorii str. Malish 7]
 gi|28262861|gb|EAA26365.1| unknown [Rickettsia sibirica 246]
          Length = 141

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 62/99 (62%), Gaps = 1/99 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
                S  S L       ++  V+YFLL+RPQ  + + R +++  +++G+ ++T +GI G
Sbjct: 25  PAETNSLQSGLTSLIPMVLIFAVFYFLLLRPQETRRKEREKLVSEVKKGEEVLTNSGIYG 84

Query: 71  KVVRVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            V +V + D  +E+EIA++VR++V++S + ++ S+++ V
Sbjct: 85  IVTKVSENDNNIEIEIAKDVRIKVLKSAIIDITSRTKEV 123


>gi|262281063|ref|ZP_06058845.1| preprotein translocase [Acinetobacter calcoaceticus RUH2202]
 gi|299768781|ref|YP_003730807.1| preprotein translocase, YajC subunit [Acinetobacter sp. DR1]
 gi|262257294|gb|EEY76030.1| preprotein translocase [Acinetobacter calcoaceticus RUH2202]
 gi|298698869|gb|ADI89434.1| preprotein translocase, YajC subunit [Acinetobacter sp. DR1]
          Length = 109

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
              T  L    +  V   ++YFL+ RPQ ++ +    ++ +L  G  +V A G++GKV +
Sbjct: 15  GPTTGILPNILMIVVFVAIFYFLIWRPQAKRAKEHRSLIESLGVGSEVVFAGGLMGKVTK 74

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +  D  + VE++  V V++ R+ V  V  +  
Sbjct: 75  IEGDYAV-VELSRGVEVKIQRASVISVLPEGT 105


>gi|239818078|ref|YP_002946988.1| preprotein translocase, YajC subunit [Variovorax paradoxus S110]
 gi|239804655|gb|ACS21722.1| preprotein translocase, YajC subunit [Variovorax paradoxus S110]
          Length = 92

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA G++GK+  +  D
Sbjct: 3   SSLGSMLPLVLMFVVLYFVMIRPQMKRQKEARAMIEALAKGDEVATAGGVLGKITSL-GD 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKS 105
             L +EIA  V +++ RS V +V  K 
Sbjct: 62  QYLGLEIANGVEIKIQRSAVVQVLPKG 88


>gi|218508783|ref|ZP_03506661.1| putative Sec translocase associated protein [Rhizobium etli Brasil
           5]
          Length = 80

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 50/80 (62%), Positives = 63/80 (78%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M  LF  L VVWYFLLIRPQR Q ++R E L+ +RRGD +VT  G+VGKV +V+DD E+E
Sbjct: 1   MIILFVPLMVVWYFLLIRPQRAQAKKREETLKAIRRGDQVVTGGGLVGKVTKVVDDKEVE 60

Query: 83  VEIAENVRVRVVRSFVSEVQ 102
           VEIA+ VRVR+VRS +SEV+
Sbjct: 61  VEIADGVRVRIVRSGISEVR 80


>gi|171464096|ref|YP_001798209.1| preprotein translocase, YajC subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193634|gb|ACB44595.1| preprotein translocase, YajC subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 108

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           +  L       ++  V YF++IRPQ ++ +    ML  L  GD +VT  GI+GKV  +  
Sbjct: 17  SGGLMSFLPLILMFAVLYFIMIRPQMKRQKETKTMLEALSVGDKVVTVGGIMGKVTALK- 75

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + VEI+    V++ +  ++ V  K  
Sbjct: 76  DQVVTVEISAGTEVQMQKGAITTVLPKGT 104


>gi|223042002|ref|ZP_03612185.1| preprotein translocase subunit YajC [Actinobacillus minor 202]
 gi|223017200|gb|EEF15629.1| preprotein translocase subunit YajC [Actinobacillus minor 202]
          Length = 101

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 54/92 (58%), Gaps = 1/92 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S LEM  +  V  +++YF++ RPQ ++ + + E+L NL +GD I+T+ G++G++ +V
Sbjct: 2   QQGSGLEMLVILAVFGIIFYFMIYRPQAKRQKEQRELLSNLAKGDEILTSGGLIGRITKV 61

Query: 76  IDDLE-LEVEIAENVRVRVVRSFVSEVQSKSE 106
             + E + + + +N  V + R+FV     K  
Sbjct: 62  SAESENVVMALNDNNEVMISRNFVVAKLPKGT 93


>gi|115379875|ref|ZP_01466937.1| preprotein translocase, YajC subunit [Stigmatella aurantiaca
          DW4/3-1]
 gi|310822780|ref|YP_003955138.1| preprotein translocase subunit YajC [Stigmatella aurantiaca
          DW4/3-1]
 gi|115363112|gb|EAU62285.1| preprotein translocase, YajC subunit [Stigmatella aurantiaca
          DW4/3-1]
 gi|309395852|gb|ADO73311.1| Preprotein translocase, YajC subunit [Stigmatella aurantiaca
          DW4/3-1]
          Length = 118

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 11 APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
          A A     SPL   G   +L  + YF++IRPQ++Q++   E+L  L++GD +VT  G+VG
Sbjct: 8  AQAPGGGASPLVNLGFIGLLVAIMYFVMIRPQQKQMKSHRELLAGLKKGDEVVTQGGLVG 67

Query: 71 KVVRVIDDLELEVEIAENVRVRVVRSFV 98
          K+  ++ D  + +E+A  VR+RV++  V
Sbjct: 68 KI-HLVSDQTVTLEVASGVRIRVLKRSV 94


>gi|229543707|ref|ZP_04432767.1| preprotein translocase, YajC subunit [Bacillus coagulans 36D1]
 gi|229328127|gb|EEN93802.1| preprotein translocase, YajC subunit [Bacillus coagulans 36D1]
          Length = 111

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   +L V++YFLLIRPQ+++ +   +M  NL +GD IVT  G+   V  + D+ +
Sbjct: 3   WAQLLPLVILFVLFYFLLIRPQQKRQKNIQQMQSNLAKGDKIVTIGGLHATVDSI-DENK 61

Query: 81  LEVEIAENVRVRVVRSFVSEV 101
           + +      R+   RS + EV
Sbjct: 62  VVLRCDNGTRLTFDRSAIREV 82


>gi|258645432|ref|ZP_05732901.1| preprotein translocase, YajC subunit [Dialister invisus DSM 15470]
 gi|260402783|gb|EEW96330.1| preprotein translocase, YajC subunit [Dialister invisus DSM 15470]
          Length = 165

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           A + L M   F +L  ++YF + RPQ++    R   L +LR+GD +VT+ G+ G +++V+
Sbjct: 4   AVNILGMFWPFLILIAIFYFFMYRPQKKLQLERGRFLLSLRKGDHVVTSGGVHG-IIKVL 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSE 100
            D  +E+EIA  V ++V ++ +  
Sbjct: 63  RDKYVELEIAPKVVIKVEKTAIHH 86


>gi|197105418|ref|YP_002130795.1| preprotein translocase, YajC subunit [Phenylobacterium zucineum
           HLK1]
 gi|196478838|gb|ACG78366.1| preprotein translocase, YajC subunit [Phenylobacterium zucineum
           HLK1]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/89 (44%), Positives = 65/89 (73%), Gaps = 1/89 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + L        L V++YFL+IRPQ+++++   +ML  L+RGD++V ++G++GKVVRV +D
Sbjct: 21  AMLIQFLPLIALVVLFYFLMIRPQQKRMKLHQQMLGALKRGDTVVLSSGMIGKVVRV-ED 79

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            E+ VEIA  V V+VV+S V++V++K EP
Sbjct: 80  KEVGVEIATGVTVKVVKSMVADVRAKGEP 108


>gi|294101592|ref|YP_003553450.1| preprotein translocase, YajC subunit [Aminobacterium colombiense
           DSM 12261]
 gi|293616572|gb|ADE56726.1| preprotein translocase, YajC subunit [Aminobacterium colombiense
           DSM 12261]
          Length = 134

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M     +  +++YF +IRPQ+++ ++  ++L  L RGD ++TA G  G +  V DD  + 
Sbjct: 21  MLFPLVIFVLIFYFFIIRPQKKRQKQHDDLLAALTRGDQVITAGGFFGIIREVKDDS-II 79

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
           +EIA+ V+VR+++S +   +S
Sbjct: 80  LEIADGVKVRILKSSIVNKRS 100


>gi|315498261|ref|YP_004087065.1| preprotein translocase, yajc subunit [Asticcacaulis excentricus CB
           48]
 gi|315416273|gb|ADU12914.1| preprotein translocase, YajC subunit [Asticcacaulis excentricus CB
           48]
          Length = 99

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/90 (38%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           T+ L     F  + V+ YFL+IRPQ+++ +     L  ++R D++V + G++GK+ RV +
Sbjct: 3   TAALVQLLPFVAIFVLMYFLIIRPQQKRAKEHQAQLNAVKRNDTVVLSNGMIGKITRV-E 61

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D ++ VEIA  V V VV+S ++EV++K EP
Sbjct: 62  DTQVMVEIASGVNVPVVKSMIAEVRTKGEP 91


>gi|254455700|ref|ZP_05069129.1| preprotein translocase, YajC subunit [Candidatus Pelagibacter sp.
          HTCC7211]
 gi|207082702|gb|EDZ60128.1| preprotein translocase, YajC subunit [Candidatus Pelagibacter sp.
          HTCC7211]
          Length = 96

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 18 TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           S +       ++ V++YF LIRPQ+++++    M+  L+RGD ++T+ GI G V R+ID
Sbjct: 3  GSGIGQFIPLILIFVIFYFFLIRPQQKKVKEHKAMVEGLKRGDKVITSGGITGTVERLID 62

Query: 78 DLELEVEIAENVRVRVVRSF 97
          + ++EVEIA+NV+V +V++ 
Sbjct: 63 NDKVEVEIADNVKVEIVKAT 82


>gi|326387927|ref|ZP_08209533.1| protein translocase subunit yajC [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207973|gb|EGD58784.1| protein translocase subunit yajC [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 118

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
           S             +AV++YFL++RPQ ++ +     +  L++GD +VTA G++ KV++V
Sbjct: 23  SEPPAYIQFLPLVAMAVIFYFLILRPQMKRQKDHQLKISELKKGDQVVTAGGLLAKVIKV 82

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +D  +E+EIA NV+VR V+S + E+    
Sbjct: 83  -EDNTVELEIAPNVKVRAVKSTLGEIVPPG 111


>gi|255027750|ref|ZP_05299736.1| hypothetical protein LmonocytFSL_17799 [Listeria monocytogenes FSL
           J2-003]
          Length = 101

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I+
Sbjct: 1   MGGIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D  + ++   N ++   R+ +  V  K   V
Sbjct: 60  DGTVILK-CGNSKLTFDRNAIRTVLEKGNAV 89


>gi|325282151|ref|YP_004254693.1| preprotein translocase, YajC subunit [Odoribacter splanchnicus DSM
           20712]
 gi|324313960|gb|ADY34513.1| preprotein translocase, YajC subunit [Odoribacter splanchnicus DSM
           20712]
          Length = 102

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
              ++ L       ++ VV++F +IRPQ ++ +       +L++GD IVT  GI GKV+ 
Sbjct: 9   QQQSNGLMNFLPLILIIVVFWFFMIRPQMKRQKELKNFRDSLKKGDKIVTTGGIYGKVLE 68

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +  D  + +E+    R+++ +S V +  + + P
Sbjct: 69  I-GDYYIIMEVEGQNRLKIDKSAVIKDMTDATP 100


>gi|312143980|ref|YP_003995426.1| preprotein translocase, YajC subunit [Halanaerobium sp.
           'sapolanicus']
 gi|311904631|gb|ADQ15072.1| preprotein translocase, YajC subunit [Halanaerobium sp.
           'sapolanicus']
          Length = 98

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L     + ++  +++F LIRPQ++Q +   +ML  L  GD IVT  GI GKVV++ D+  
Sbjct: 4   LYAILPWILIFGIFWFFLIRPQQKQKKEHQDMLDKLSVGDQIVTIGGIKGKVVKIRDNN- 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
           + + ++ NV +  ++S +S+V+ KS
Sbjct: 63  VRIRVSSNVDIDFIKSAISKVKEKS 87


>gi|163802456|ref|ZP_02196349.1| preprotein translocase subunit YajC [Vibrio sp. AND4]
 gi|159173757|gb|EDP58572.1| preprotein translocase subunit YajC [Vibrio sp. AND4]
          Length = 109

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
            EM  +  + AV++YF++ RPQ ++++    ++ ++ +GD ++T+ G+VGK+ ++ +D +
Sbjct: 19  FEMLIMLGMFAVIFYFMIYRPQSKRVKEHKNLMSSMGKGDEVLTSGGLVGKITKIAEDND 78

Query: 81  -LEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +E+  N  V + + FV+ V  K  
Sbjct: 79  FISIELNVNNEVVIKKDFVTAVLPKGT 105


>gi|260072735|gb|ACX30631.1| preprotein translocase subunit YajC [uncultured bacterium
           ARCTIC96BD-19]
          Length = 112

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L        + V+ YFLLIRPQ+++ +    +L+ L++GD +VT  GI+GK+  V D+  
Sbjct: 3   LPPELFLIAMFVLMYFLLIRPQQKRAKDHKNLLKALKKGDEVVTNGGIIGKISAV-DESF 61

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
            E+EIA  V V+V +  +++   K 
Sbjct: 62  AELEIASGVSVKVQKQGINQKMPKG 86


>gi|238755134|ref|ZP_04616481.1| hypothetical protein yruck0001_23280 [Yersinia ruckeri ATCC 29473]
 gi|238706694|gb|EEP99064.1| hypothetical protein yruck0001_23280 [Yersinia ruckeri ATCC 29473]
          Length = 85

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 50/81 (61%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  V  +++YF+++RPQ+++ +   +++ ++ +GD ++T  G++G+V++V +   + + +
Sbjct: 1   MLVVFGLIFYFMILRPQQKRSKEHKKLMDSIGKGDEVLTTGGLIGRVIKVAETGYIVIAL 60

Query: 86  AENVRVRVVRSFVSEVQSKSE 106
            +   V + R FV+ V  K  
Sbjct: 61  NDTTEVMIKRDFVAAVLPKGT 81


>gi|269797659|ref|YP_003311559.1| preprotein translocase subunit YajC [Veillonella parvula DSM 2008]
 gi|282850104|ref|ZP_06259486.1| preprotein translocase, YajC subunit [Veillonella parvula ATCC
           17745]
 gi|294793307|ref|ZP_06758452.1| preprotein translocase, YajC subunit [Veillonella sp. 6_1_27]
 gi|294795129|ref|ZP_06760263.1| preprotein translocase, YajC subunit [Veillonella sp. 3_1_44]
 gi|269094288|gb|ACZ24279.1| preprotein translocase, YajC subunit [Veillonella parvula DSM 2008]
 gi|282580293|gb|EFB85694.1| preprotein translocase, YajC subunit [Veillonella parvula ATCC
           17745]
 gi|294453921|gb|EFG22296.1| preprotein translocase, YajC subunit [Veillonella sp. 3_1_44]
 gi|294455738|gb|EFG24103.1| preprotein translocase, YajC subunit [Veillonella sp. 6_1_27]
          Length = 96

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 57/84 (67%), Gaps = 1/84 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L+ +    ++ V++YFLL RPQ++Q + RA +L +L++G  IVT  GI G++V + DD +
Sbjct: 8   LQTSWPILLMVVIFYFLLWRPQKKQQKERASLLGSLKKGQKIVTIGGIYGEIVEL-DDEK 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSK 104
           ++V+++E V +   R+ V+ V SK
Sbjct: 67  VKVQVSEKVELTFARTAVANVLSK 90


>gi|237654065|ref|YP_002890379.1| preprotein translocase subunit YajC [Thauera sp. MZ1T]
 gi|237625312|gb|ACR02002.1| preprotein translocase, YajC subunit [Thauera sp. MZ1T]
          Length = 108

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           T  L       ++ VV +FL+IRPQ ++ +    M+  L +GD +VT  GI G+VV V  
Sbjct: 17  TGGLMGLLPLILMFVVLWFLMIRPQMKRAKEHKAMVEALAKGDEVVTGGGIAGRVVEV-G 75

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  +++E+A N  V   +  V+ V  K  
Sbjct: 76  DSFVQIEVAPNTVVAAQKQAVATVLPKGT 104


>gi|146295339|ref|YP_001179110.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145408915|gb|ABP65919.1| protein translocase subunit yajC [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 123

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 62/115 (53%), Gaps = 8/115 (6%)

Query: 1   MFTTVYA----QSDAPAITSATSPL----EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEM 52
           +F   +A    QS +    +  + +    ++     ++  ++Y  +I PQR++ ++  +M
Sbjct: 7   LFEVAFATNNTQSSSNQAPAGATWVVVFTQLILPLILMFAIFYIFIILPQRRREKQFRDM 66

Query: 53  LRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           + +L  GD IVT  GIVGK+V + DD+      A+ V+++V +  V EV  K+EP
Sbjct: 67  INSLIVGDEIVTNGGIVGKIVNIKDDILTIEVGADRVKLKVYKWAVKEVLKKAEP 121


>gi|221069817|ref|ZP_03545922.1| preprotein translocase, YajC subunit [Comamonas testosteroni KF-1]
 gi|220714840|gb|EED70208.1| preprotein translocase, YajC subunit [Comamonas testosteroni KF-1]
          Length = 90

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++ VV YF++IRPQ ++ +    M+  L +GD + TA GI+G V R+ +
Sbjct: 1   MGSLTGMLPLVLMFVVLYFVMIRPQMKRQKEHRSMIDALAKGDEVATAGGIIGTVTRMAE 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
              + +E+A  V V++ RS V +V  K  
Sbjct: 61  -QFIYIEVASGVEVQIQRSAVVQVLPKGT 88


>gi|262371658|ref|ZP_06064937.1| preprotein translocase subunit [Acinetobacter junii SH205]
 gi|262311683|gb|EEY92768.1| preprotein translocase subunit [Acinetobacter junii SH205]
          Length = 109

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S +    +  V   ++YFL+ RPQ ++ +    ++ +L  G  IV A G++GK+ ++
Sbjct: 16  QGPSLMANLLMIAVFIAIFYFLIWRPQAKRAKEHRSLIESLGVGSEIVFAGGLMGKITKL 75

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D  + VE++  V V++ R+ V  V  +  
Sbjct: 76  DGDFAV-VELSRGVEVKIQRASVISVLPEGT 105


>gi|302866774|ref|YP_003835411.1| preprotein translocase subunit YajC [Micromonospora aurantiaca ATCC
           27029]
 gi|315503189|ref|YP_004082076.1| preprotein translocase, yajc subunit [Micromonospora sp. L5]
 gi|302569633|gb|ADL45835.1| preprotein translocase, YajC subunit [Micromonospora aurantiaca
           ATCC 27029]
 gi|315409808|gb|ADU07925.1| preprotein translocase, YajC subunit [Micromonospora sp. L5]
          Length = 123

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +  +L VV YF++IRPQ+++ +   +M   L  GD +VT  G+ G V  V +D  
Sbjct: 23  LTPILMIALLFVVMYFMMIRPQQKRRREAEQMQSALAPGDEVVTIGGLHGTVTAV-EDET 81

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +E+A  V+ R  R  V+ V  ++E
Sbjct: 82  VLLEVAPGVQTRYARPAVARVIKRAE 107


>gi|148245037|ref|YP_001219731.1| preprotein translocase YajC subunit [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326864|dbj|BAF62007.1| preprotein translocase YajC subunit [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 113

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +   V+A+    + +S            V+  + YFLLIRPQ+++ +    +L  L+ GD
Sbjct: 7   IIVPVFAEGL-VSESSILDSWSGLPFLLVMFALMYFLLIRPQQKRAKEHKTLLVALKTGD 65

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +VT  GI+GKVV V +   + +EIA  + V+V +  +++   K 
Sbjct: 66  EVVTNGGIIGKVVSVDESFAI-LEIANGILVKVQKQGINQKMPKG 109


>gi|330830091|ref|YP_004393043.1| preprotein translocase subunit YajC [Aeromonas veronii B565]
 gi|328805227|gb|AEB50426.1| Preprotein translocase, YajC subunit [Aeromonas veronii B565]
          Length = 111

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV-IDDL 79
           +EM  +  V  +++YF++ RPQ ++ +    ++ +L +GD ++T+ G+VGK+ +V  D  
Sbjct: 21  MEMIIMLAVFGLIFYFMIYRPQAKRAKDHRNLMSSLSKGDEVLTSGGLVGKIAKVAADSD 80

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKS 105
            L + + +  +V + + FVS V  K 
Sbjct: 81  YLVIALNDQTQVTIKKDFVSAVLPKG 106


>gi|255022136|ref|ZP_05294139.1| preprotein translocase, YajC subunit [Acidithiobacillus caldus ATCC
           51756]
 gi|254968400|gb|EET25959.1| preprotein translocase, YajC subunit [Acidithiobacillus caldus ATCC
           51756]
          Length = 112

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              + +       V+  ++YFLLIRPQ ++ + +  ++  + +GD +VT  G+ G+V++ 
Sbjct: 19  GPEAMIVQFLPLIVIFGIFYFLLIRPQMKRAKEQRALIAAVSKGDEVVTNGGLAGRVMQA 78

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++  L +E+AE V V+V R+ VS +  K  
Sbjct: 79  GEE-YLHLEVAEGVVVKVQRNAVSLMLPKGT 108


>gi|269792828|ref|YP_003317732.1| preprotein translocase, YajC subunit [Thermanaerovibrio
          acidaminovorans DSM 6589]
 gi|269100463|gb|ACZ19450.1| preprotein translocase, YajC subunit [Thermanaerovibrio
          acidaminovorans DSM 6589]
          Length = 109

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 14 ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
                 + M     +  V++YFL+IRPQ+++ +   EML ++ RGD +VTA G  G V 
Sbjct: 2  GNQQQGLMGMLMPLALFVVIFYFLIIRPQKKKQKAHEEMLASISRGDKVVTAGGFFGTVR 61

Query: 74 RVIDDLELEVEIAENVRVRVVRSFVS 99
           ++DD  + +E+ E V++R+++  +S
Sbjct: 62 DILDDSFI-IEVDEGVKMRILKGSIS 86


>gi|226946085|ref|YP_002801158.1| preprotein translocase subunit YajC [Azotobacter vinelandii DJ]
 gi|226721012|gb|ACO80183.1| preprotein translocase, YajC subunit [Azotobacter vinelandii DJ]
          Length = 111

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ +    +L  L++GD +VT  GI G+V +V DD  + +E
Sbjct: 27  IFLVGFLVIFYLMIWRPQAKRAKEHKNLLSGLQKGDEVVTTGGIAGRVNKVADDF-VVLE 85

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V +++ +  +     K  
Sbjct: 86  VSDTVELKIQKGAIVASLPKGT 107


>gi|308273583|emb|CBX30185.1| UPF0092 membrane protein BH1229 [uncultured Desulfobacterium sp.]
          Length = 92

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 52/75 (69%), Gaps = 1/75 (1%)

Query: 25 GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
              ++ V++YFLLIRPQ+++ +   EM+ NL++GD IVT+ GI G +  + DD  + VE
Sbjct: 1  MPLVLMFVIFYFLLIRPQQKKAKEHREMIANLKKGDKIVTSGGIYGIITGM-DDNTITVE 59

Query: 85 IAENVRVRVVRSFVS 99
          IA+ VR+++ R+ V+
Sbjct: 60 IADKVRIKLNRANVA 74


>gi|291278526|ref|YP_003495361.1| preprotein translocase subunit YajC [Deferribacter desulfuricans
           SSM1]
 gi|290753228|dbj|BAI79605.1| preprotein translocase subunit YajC [Deferribacter desulfuricans
           SSM1]
          Length = 107

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 63/107 (58%), Gaps = 4/107 (3%)

Query: 1   MF-TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MF +  YA    PA     +P+       ++ V++YFLLIRPQ+++ ++  +M+ +L+ G
Sbjct: 1   MFESIAYAAGGQPAGQ---NPIAAFLPLILIFVIFYFLLIRPQQKRQKQHQQMIESLKAG 57

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D I+T+ GI GK+ +VID     VEIA  V+++VV+S ++       
Sbjct: 58  DEIITSGGIYGKIDKVIDQNTFLVEIANGVKIKVVKSAIASKIGGGT 104


>gi|229592460|ref|YP_002874579.1| preprotein translocase subunit YajC [Pseudomonas fluorescens SBW25]
 gi|312962924|ref|ZP_07777411.1| preprotein translocase YajC subunit [Pseudomonas fluorescens WH6]
 gi|229364326|emb|CAY52077.1| putative membrane protein [Pseudomonas fluorescens SBW25]
 gi|311282951|gb|EFQ61545.1| preprotein translocase YajC subunit [Pseudomonas fluorescens WH6]
          Length = 112

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                  V++Y ++ RPQ ++ + +  +L +L++GD +VT  GI GK+ +V D   + +E
Sbjct: 28  IFLVGFLVIFYLMIWRPQAKRAKEQKNLLGSLQKGDEVVTTGGIAGKITKVSDAF-VVLE 86

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
           +++ V ++  +  ++    K  
Sbjct: 87  VSDTVEMKFQKGAIAATLPKGT 108


>gi|315186569|gb|EFU20328.1| protein translocase subunit yajC [Spirochaeta thermophila DSM 6578]
          Length = 118

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 4   TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
              A   A   +++   +     F ++ +++YFL+IRPQ ++ +   +ML +L +GD +V
Sbjct: 11  LAAAPEGAQGASTSGQMMVTLITFGLIFLIFYFLIIRPQNKRQKEVQQMLASLDKGDEVV 70

Query: 64  TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           T  GI G V  V +D  + +++ ++  + + +S ++ 
Sbjct: 71  TIGGIHGVVQSVKEDS-VVIKVDDHTTLLMEKSAIAR 106


>gi|217964324|ref|YP_002350002.1| preprotein translocase, YajC subunit [Listeria monocytogenes HCC23]
 gi|290893887|ref|ZP_06556865.1| preprotein translocase [Listeria monocytogenes FSL J2-071]
 gi|217333594|gb|ACK39388.1| preprotein translocase, YajC subunit [Listeria monocytogenes HCC23]
 gi|290556604|gb|EFD90140.1| preprotein translocase [Listeria monocytogenes FSL J2-071]
 gi|307571110|emb|CAR84289.1| preprotein translocase subunit [Listeria monocytogenes L99]
 gi|313608659|gb|EFR84504.1| preprotein translocase, YajC subunit [Listeria monocytogenes FSL
           F2-208]
          Length = 105

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I+
Sbjct: 1   MGGIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKS 105
           D  + ++   N ++   R+ +  V  K 
Sbjct: 60  DGTVILK-CGNSKLTFDRNAIRTVLEKG 86


>gi|332531796|ref|ZP_08407681.1| preprotein translocase, subunit YajC [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332038772|gb|EGI75214.1| preprotein translocase, subunit YajC [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 111

 Score = 91.3 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
            EM  +  +  +V+YFL+ RPQ ++++    ++  + +GD ++T  G+VGK+V++ ++  
Sbjct: 21  WEMLIMLAIFGLVFYFLIYRPQAKRVKEHKSLMSMMAKGDEVLTQGGLVGKIVKISEEKD 80

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + + + E   V V +S VS V  K  
Sbjct: 81  FIVISLNEQAEVTVQKSAVSAVLPKGT 107


>gi|315303289|ref|ZP_07873924.1| preprotein translocase, YajC subunit [Listeria ivanovii FSL F6-596]
 gi|313628336|gb|EFR96834.1| preprotein translocase, YajC subunit [Listeria ivanovii FSL F6-596]
          Length = 109

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I+
Sbjct: 1   MGGIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D  + ++   N ++   R+ V  V  K   V
Sbjct: 60  DGTVILKCGNN-KLTFDRNAVRTVLEKGNTV 89


>gi|332525402|ref|ZP_08401562.1| protein translocase subunit yajC [Rubrivivax benzoatilyticus JA2]
 gi|332108671|gb|EGJ09895.1| protein translocase subunit yajC [Rubrivivax benzoatilyticus JA2]
          Length = 107

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF +      A     A S L       ++ VV YF++IRPQ ++ +    M+  L +GD
Sbjct: 1   MFISSAFAQAAAPAGGAESSLFSLLPLVLMFVVLYFIMIRPQMKKQKEHKAMVEALAKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +V A G++G+V ++  D  + VE+A+ V ++V R  V +V  K 
Sbjct: 61  EVVIAGGVIGRVAKLS-DSIIHVEVADGVELQVQRVSVLQVLPKG 104


>gi|253700406|ref|YP_003021595.1| preprotein translocase subunit YajC [Geobacter sp. M21]
 gi|251775256|gb|ACT17837.1| preprotein translocase, YajC subunit [Geobacter sp. M21]
          Length = 105

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             +  +       +  ++YFLLIRPQ+++ +    +L  L++GD +VTA G+ GKV  + 
Sbjct: 19  MMAQFQGLIPLVFMFAIFYFLLIRPQQKKAKEHRALLEALKKGDQVVTAGGMHGKVTAL- 77

Query: 77  DDLELEVEIAENVRVRVVRSFVSEV 101
           DD  + +EIA  V VR+ + +++ +
Sbjct: 78  DDQVVTLEIAPGVNVRINKGYIASI 102


>gi|329926740|ref|ZP_08281148.1| preprotein translocase, YajC subunit [Paenibacillus sp. HGF5]
 gi|328938940|gb|EGG35308.1| preprotein translocase, YajC subunit [Paenibacillus sp. HGF5]
          Length = 103

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            A         L +   F ++ V++YFLLIRPQ+++ + R  ML  L +GD +VT  G+ 
Sbjct: 8   AAGQTQGGGGILGLILPFVLMFVIFYFLLIRPQQKKQKTRNAMLSALSKGDKVVTIGGLH 67

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           G +V + DD  + +++ +  ++   R+ VS 
Sbjct: 68  GTIVEITDD-IVVLKVNDVTKLTFDRNSVSH 97


>gi|282852797|ref|ZP_06262139.1| preprotein translocase, YajC subunit [Lactobacillus gasseri 224-1]
 gi|282556539|gb|EFB62159.1| preprotein translocase, YajC subunit [Lactobacillus gasseri 224-1]
          Length = 145

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 5/102 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M T   AQS A       + + M      + V +YF +I+PQ++Q Q R +M+  L++GD
Sbjct: 1   MNTFFLAQSAA-----GMNNMFMIIAMIAIFVFFYFSMIKPQKKQQQERMKMMSELKKGD 55

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
            ++   G+ GKV  + D  +  V  A+ + +   R  +  V 
Sbjct: 56  QVIMVDGLHGKVDSINDADKTVVIDADGIFLTFERMAIRRVL 97


>gi|143757667|sp|Q4UKW4|Y958_RICFE RecName: Full=UPF0092 membrane protein RF_0958
          Length = 142

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+YFLL+RPQ ++ + R +++  +++G+ ++T +GI G V 
Sbjct: 28  TNSLQSGLTSLTPMVLIFAVFYFLLLRPQEKRRKEREKLVSEVKKGEEVLTNSGIYGIVT 87

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V + D  +E+EIA++VR++ ++S + ++ S+++ V
Sbjct: 88  KVSENDNNIEIEIAKDVRIKALKSAIVDITSRTKEV 123


>gi|332704178|ref|ZP_08424266.1| preprotein translocase, YajC subunit [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554327|gb|EGJ51371.1| preprotein translocase, YajC subunit [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 128

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 54/81 (66%), Gaps = 1/81 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           +P+       ++  ++YFLLIRPQ+++ +   E L  L+RGD ++T+ GI G+++ V D 
Sbjct: 22  NPIASFLPLILMFAIFYFLLIRPQQKKAKMHREFLGGLKRGDYVLTSGGIYGRIIDV-DG 80

Query: 79  LELEVEIAENVRVRVVRSFVS 99
             L VEIA+++ ++V RSF+S
Sbjct: 81  DVLTVEIAKDMSIKVNRSFIS 101


>gi|319760366|ref|YP_004124304.1| preprotein translocase, YajC subunit [Candidatus Blochmannia vafer
           str. BVAF]
 gi|318039080|gb|ADV33630.1| preprotein translocase, YajC subunit [Candidatus Blochmannia vafer
           str. BVAF]
          Length = 115

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/111 (22%), Positives = 59/111 (53%), Gaps = 8/111 (7%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +   V+A S+        +P  +  +  + A+++YF++ RPQ+++ +   E+L ++ +GD
Sbjct: 4   LINKVWANSN---TVDQGNPYSLIIMLLLFAIIFYFVIFRPQQKRNKEHKELLNSITKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAE-----NVRVRVVRSFVSEVQSKSE 106
            I+T+ G+VG+V+R+ +   + + +       N  V + +  V+ +  K  
Sbjct: 61  EIITSGGLVGRVLRITETGYIFITLNFKDTDINNEVLIKKDCVTAILPKGT 111


>gi|255692805|ref|ZP_05416480.1| preprotein translocase, YajC subunit [Bacteroides finegoldii DSM
          17565]
 gi|260621434|gb|EEX44305.1| preprotein translocase, YajC subunit [Bacteroides finegoldii DSM
          17565]
          Length = 107

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 12 PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
            + +A     M  +   + V+ YF +IRPQ ++ +  A   ++L+   S++TA GI G 
Sbjct: 10 APVGAAGGGSMMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQSVITAGGIHGT 69

Query: 72 VVRVIDDLELEVEIAENVRVRVVRSFV 98
          +  + DD  + +EIA NV++++ ++ +
Sbjct: 70 IKEINDD-YVVLEIASNVKIKIDKNSI 95


>gi|330836189|ref|YP_004410830.1| preprotein translocase, YajC subunit [Spirochaeta coccoides DSM
           17374]
 gi|329748092|gb|AEC01448.1| preprotein translocase, YajC subunit [Spirochaeta coccoides DSM
           17374]
          Length = 161

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +     F ++A ++YF++IRPQR++ +    M+  +++GD +VT  GI G +V V +   
Sbjct: 23  IPTLVTFGLVAFIFYFMIIRPQRKRDKEAKNMIAAIKKGDRVVTIGGIYGTIVTVKE-NT 81

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS-EPV 108
           + +++ +N R+   +S +S V +K  EPV
Sbjct: 82  VVLKVDDNARLEFAKSAISSVVNKKVEPV 110


>gi|224538937|ref|ZP_03679476.1| hypothetical protein BACCELL_03834 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|224519455|gb|EEF88560.1| hypothetical protein BACCELL_03834 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 109

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 55/95 (57%), Gaps = 4/95 (4%)

Query: 4  TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
          TV+ Q+ A A    +    M  L   +  + YF +IRPQ ++ +  A   ++L+    ++
Sbjct: 5  TVFLQAPAAAPGGGS---MMWILLIAMFAIMYFFMIRPQNKKQKEIANFRKSLQVNQKVI 61

Query: 64 TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
          TA GI G V++ I+D ++ +EIA NV++R+ ++ +
Sbjct: 62 TAGGIHG-VIKEINDNDIVLEIASNVKIRIDKNSI 95


>gi|15606479|ref|NP_213859.1| hypothetical protein aq_1254 [Aquifex aeolicus VF5]
 gi|6647993|sp|O67295|Y1254_AQUAE RecName: Full=UPF0092 membrane protein aq_1254
 gi|2983702|gb|AAC07266.1| hypothetical protein aq_1254 [Aquifex aeolicus VF5]
          Length = 102

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
             +   + L        + +++YFL+IRPQ+++ +R  + L +L++GD ++T++GI G V
Sbjct: 3   QQSPVGALLFQIIFLVAIFLMFYFLIIRPQKKERERHRKFLESLKKGDKVITSSGIWGTV 62

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           V +  D  + +++  N ++   +  +   Q 
Sbjct: 63  VEI-GDRTITLKVDANTKITFSKEAIVAYQP 92


>gi|119468101|ref|ZP_01611227.1| preprotein translocase subunit YajC [Alteromonadales bacterium
           TW-7]
 gi|119448094|gb|EAW29358.1| preprotein translocase subunit YajC [Alteromonadales bacterium
           TW-7]
          Length = 111

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
           +EM  +  +  +V+YFL+ RPQ ++++    ++  + +GD ++T  G+VGK+V++ +D  
Sbjct: 21  MEMLIMLAIFGLVFYFLIYRPQAKRVKEHKGLMNAMAKGDEVLTQGGLVGKIVKIAEDKD 80

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + + + E   V V ++ VS V  K  
Sbjct: 81  FIVISLNEQAEVTVQKASVSAVLPKGT 107


>gi|32491004|ref|NP_871258.1| hypothetical protein WGLp255 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166210|dbj|BAC24401.1| yajC [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 113

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 55/98 (56%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
             +    S  +P  +  +  V ++++YF+++RPQ+++     +++ +L  GD ++T++G 
Sbjct: 11  DSSAIPNSQNNPYTLLIMLLVFSIIFYFIILRPQQKRANAHKKLMLSLSNGDEVLTSSGF 70

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +G ++++     + +++ EN  V + + F++ +  K  
Sbjct: 71  IGYILKITSSDYVVLKLNENNSVLIKKDFITSILPKGT 108


>gi|239827854|ref|YP_002950478.1| preprotein translocase subunit YajC [Geobacillus sp. WCH70]
 gi|239808147|gb|ACS25212.1| preprotein translocase, YajC subunit [Geobacillus sp. WCH70]
          Length = 91

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 50/90 (55%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            ++ +       +  V++YFLL+RPQ+++ +   +M  NL++GD I+T  G+ G +  V 
Sbjct: 1   MSATIANLLPIILFFVIFYFLLLRPQQKRQREIQQMQANLKKGDKIITIGGLHGIIDSVD 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +D  + +   +  R+   RS V EV ++ E
Sbjct: 61  EDK-VVIRAGDGTRLTYDRSAVREVVTEKE 89


>gi|163790790|ref|ZP_02185216.1| hypothetical protein CAT7_02312 [Carnobacterium sp. AT7]
 gi|159873970|gb|EDP68048.1| hypothetical protein CAT7_02312 [Carnobacterium sp. AT7]
          Length = 125

 Score = 91.0 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +     +     F  +  + YF++IRPQ++   +  +ML  +++GD+IVT  G+ G +  
Sbjct: 10  SEMMELILNFLPFIAIMALMYFMMIRPQKKAATKTQDMLNAMKKGDAIVTIGGLHGVIDE 69

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKS--EPV 108
           V       V   + + +   +  ++ V +     PV
Sbjct: 70  VNTTNNTIVIDCDGIFLTFEKKAIARVVTSGVSTPV 105


>gi|84517343|ref|ZP_01004697.1| preprotein translocase, YajC subunit [Loktanella vestfoldensis
           SKA53]
 gi|84508823|gb|EAQ05286.1| preprotein translocase, YajC subunit [Loktanella vestfoldensis
           SKA53]
          Length = 93

 Score = 91.0 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/85 (45%), Positives = 59/85 (69%), Gaps = 1/85 (1%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-LELE 82
             +  ++  + YFLLIRPQ+++++  A ML  LRRGD +VT  G+VGK+V+V D+  E+E
Sbjct: 6   LVMLLLIFGIMYFLLIRPQQKRVKEHAAMLAALRRGDQVVTQGGVVGKIVKVKDEVSEVE 65

Query: 83  VEIAENVRVRVVRSFVSEVQSKSEP 107
           VEIA  V VRV++  +  V +K+EP
Sbjct: 66  VEIASGVIVRVMKPTIVSVLNKTEP 90


>gi|302038580|ref|YP_003798902.1| preprotein translocase subunit YajC [Candidatus Nitrospira
           defluvii]
 gi|300606644|emb|CBK42977.1| Preprotein translocase, subunit YajC [Candidatus Nitrospira
           defluvii]
          Length = 106

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           +  +AQ  + +   A   L     F ++ V++YF+LI PQ+++ ++   M+  L++GD +
Sbjct: 4   SVAWAQGTSGSTG-AGGGLLSLVPFVLIFVIFYFMLILPQQKRQKQLKTMMETLKKGDKV 62

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           VTA+GI G +  +  D  + ++IA+  ++++ +  ++ ++ + E
Sbjct: 63  VTASGIWGTITNLGKD-TVTLQIADTTKIKIQKEHIARLRGEEE 105


>gi|227529696|ref|ZP_03959745.1| protein translocase subunit yajC [Lactobacillus vaginalis ATCC
           49540]
 gi|227350362|gb|EEJ40653.1| protein translocase subunit yajC [Lactobacillus vaginalis ATCC
           49540]
          Length = 146

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 38/80 (47%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             L  ++  + YF +IRPQ++Q ++  +M+  L +GD +VT   + GK+  +  +     
Sbjct: 16  MILIILMIALMYFFMIRPQQKQRKQHQDMMSQLHKGDEVVTIGRMHGKIDSINREDRTVT 75

Query: 84  EIAENVRVRVVRSFVSEVQS 103
              E + +      ++ V  
Sbjct: 76  LDCEGIYLTFDMVAIARVVK 95


>gi|303230224|ref|ZP_07316992.1| preprotein translocase, YajC subunit [Veillonella atypica
           ACS-134-V-Col7a]
 gi|303231809|ref|ZP_07318525.1| preprotein translocase, YajC subunit [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513516|gb|EFL55542.1| preprotein translocase, YajC subunit [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302515150|gb|EFL57124.1| preprotein translocase, YajC subunit [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 96

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 56/84 (66%), Gaps = 1/84 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L+ +    ++ V++YFLL RPQ++Q + R  +L +L++G  IVT  GI G+++ + DD +
Sbjct: 8   LQTSWPILLMVVIFYFLLWRPQKKQQKERTNLLSSLKKGQKIVTIGGIYGEIIEL-DDEK 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSK 104
           ++V++AE V +   R+ ++ V SK
Sbjct: 67  VKVQVAEKVEMTFARTAIASVVSK 90


>gi|157825966|ref|YP_001493686.1| preprotein translocase subunit YajC [Rickettsia akari str.
           Hartford]
 gi|157799924|gb|ABV75178.1| preprotein translocase subunit YajC [Rickettsia akari str.
           Hartford]
          Length = 142

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             +  S L       ++  V+YFLL+RPQ ++ +   +++ N+++G+ ++T +GI G V 
Sbjct: 28  TNALQSGLTSLIPMVLIFAVFYFLLLRPQEKRRKEIEKLVSNVKKGEEVLTNSGIYGIVT 87

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V + D  +E+EIA++VR++ ++S + ++ S+++ V
Sbjct: 88  KVSENDNNVEIEIAKDVRIKALKSAIIDITSRTKKV 123


>gi|296284695|ref|ZP_06862693.1| hypothetical protein CbatJ_13793 [Citromicrobium bathyomarinum
           JL354]
          Length = 104

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 57/86 (66%), Gaps = 2/86 (2%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                 F  + ++++FL+IRPQ ++ +   E +  L++GD +VTA G++GK+V V DD E
Sbjct: 17  WIQFLPFVGMILIFWFLIIRPQMKRQKEHQEKIGGLKKGDRVVTAGGLIGKIVAVRDD-E 75

Query: 81  LEVEIAENVRVRVVRSFVSEV-QSKS 105
           +E+E+A +VRV+ V+S + +V   K+
Sbjct: 76  VELELARDVRVKAVKSTIGDVILPKA 101


>gi|189467493|ref|ZP_03016278.1| hypothetical protein BACINT_03882 [Bacteroides intestinalis DSM
          17393]
 gi|189435757|gb|EDV04742.1| hypothetical protein BACINT_03882 [Bacteroides intestinalis DSM
          17393]
          Length = 109

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 53/95 (55%), Gaps = 4/95 (4%)

Query: 4  TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
          TV+ Q+ A A    +    M  L   +  + YF +IRPQ ++ +  A   ++L+    ++
Sbjct: 5  TVFLQAPAAAPGGGS---MMWILLIAMFAIMYFFMIRPQNKKQKEIANFRKSLQVNQKVI 61

Query: 64 TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
          TA GI G +  + +D ++ +EIA NVR+R+ ++ +
Sbjct: 62 TAGGIHGVIKEI-NDNDIVLEIASNVRIRIDKNSI 95


>gi|296113227|ref|YP_003627165.1| protein translocase subunit YajC [Moraxella catarrhalis RH4]
 gi|295920921|gb|ADG61272.1| protein translocase subunit YajC [Moraxella catarrhalis RH4]
 gi|326560221|gb|EGE10609.1| protein translocase subunit YajC [Moraxella catarrhalis 7169]
 gi|326562865|gb|EGE13152.1| protein translocase subunit YajC [Moraxella catarrhalis 46P47B1]
 gi|326563693|gb|EGE13945.1| protein translocase subunit YajC [Moraxella catarrhalis 103P14B1]
 gi|326565228|gb|EGE15413.1| protein translocase subunit YajC [Moraxella catarrhalis 12P80B1]
 gi|326570269|gb|EGE20314.1| protein translocase subunit YajC [Moraxella catarrhalis BC8]
 gi|326573303|gb|EGE23271.1| protein translocase subunit YajC [Moraxella catarrhalis 101P30B1]
 gi|326575800|gb|EGE25723.1| protein translocase subunit YajC [Moraxella catarrhalis CO72]
 gi|326576880|gb|EGE26786.1| protein translocase subunit YajC [Moraxella catarrhalis O35E]
          Length = 111

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            T  +A + APA     S L    +      ++YFL+IRPQ ++ ++   M+  L  G+ 
Sbjct: 6   ITAAHASTGAPA--GQQSLLMNLLIPVAFFAIFYFLIIRPQSKRNKQHKAMVDGLTVGNE 63

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +V A G++G++ +V  D  + + +  +  V++ R+ V  V     
Sbjct: 64  VVFAGGLIGRIKKVEGDYAV-ITLNHSTEVKIQRASVVMVLPTGT 107


>gi|91205516|ref|YP_537871.1| preprotein translocase subunit YajC [Rickettsia bellii RML369-C]
 gi|122425640|sp|Q1RIN2|Y701_RICBR RecName: Full=UPF0092 membrane protein RBE_0701
 gi|91069060|gb|ABE04782.1| Preprotein translocase YajC subunit [Rickettsia bellii RML369-C]
          Length = 146

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+YFLL+RPQ ++ + R +++  +++G+ ++T +GI G V 
Sbjct: 29  TNSLQSGLTSLIPMVLIFAVFYFLLLRPQEKRRKEREKLVSEVKKGEEVLTNSGIYGIVT 88

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V + +  +EVEIA++VR++ ++S + ++ S+S+ V
Sbjct: 89  KVSESEPNIEVEIAKDVRIKALKSAIVDITSRSKDV 124


>gi|302879496|ref|YP_003848060.1| preprotein translocase, YajC subunit [Gallionella capsiferriformans
           ES-2]
 gi|302582285|gb|ADL56296.1| preprotein translocase, YajC subunit [Gallionella capsiferriformans
           ES-2]
          Length = 107

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                    L  V+YFL++RPQ+ + +    M+  L+RGD +VT  G +G+V +V +   
Sbjct: 18  FMEYLPLVALVAVFYFLVLRPQQTRAKEHKAMVEALQRGDEVVTIGGELGRVTKVFEA-Y 76

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + VE+AEN+ V V ++ +  V  K  
Sbjct: 77  VGVELAENLEVTVQKTAIQAVLPKGT 102


>gi|53712492|ref|YP_098484.1| hypothetical protein BF1200 [Bacteroides fragilis YCH46]
 gi|60680692|ref|YP_210836.1| hypothetical protein BF1167 [Bacteroides fragilis NCTC 9343]
 gi|253563477|ref|ZP_04840934.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|255007969|ref|ZP_05280095.1| hypothetical protein Bfra3_02443 [Bacteroides fragilis 3_1_12]
 gi|265762655|ref|ZP_06091223.1| preprotein translocase subunit [Bacteroides sp. 2_1_16]
 gi|313145685|ref|ZP_07807878.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|52215357|dbj|BAD47950.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
 gi|60492126|emb|CAH06889.1| conserved hypothetical protein with preprotein translocase motif
          [Bacteroides fragilis NCTC 9343]
 gi|251947253|gb|EES87535.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263255263|gb|EEZ26609.1| preprotein translocase subunit [Bacteroides sp. 2_1_16]
 gi|301162219|emb|CBW21764.1| conserved hypothetical protein with preprotein translocase motif
          [Bacteroides fragilis 638R]
 gi|313134452|gb|EFR51812.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 108

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 53/95 (55%), Gaps = 5/95 (5%)

Query: 4  TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
          TV+ Q+ A     +     M  +   + V+ YF +IRPQ ++ +  A   ++L+   +++
Sbjct: 5  TVFFQAPAAGPDGS----LMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQNVI 60

Query: 64 TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
          TA GI G +  + DD  + +EIA NV++++ ++ +
Sbjct: 61 TAGGIHGVIKEINDD-YIVLEIASNVKIKIDKNSI 94


>gi|121535584|ref|ZP_01667391.1| preprotein translocase, YajC subunit [Thermosinus carboxydivorans
           Nor1]
 gi|121305824|gb|EAX46759.1| preprotein translocase, YajC subunit [Thermosinus carboxydivorans
           Nor1]
          Length = 101

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 52/81 (64%), Gaps = 1/81 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            ++ +    ++ V++YFLL RPQ+++ ++R EML  L++GD IVT  GI G +  + +D 
Sbjct: 11  FIQASWPIVLMGVIFYFLLYRPQQKEQKKRTEMLNALKKGDRIVTIGGIYGTITAI-NDK 69

Query: 80  ELEVEIAENVRVRVVRSFVSE 100
            + +++A+ V + + R+ VS 
Sbjct: 70  VVTLKVADKVEIEIARTAVSH 90


>gi|149186991|ref|ZP_01865299.1| preprotein translocase, YajC subunit [Erythrobacter sp. SD-21]
 gi|148829380|gb|EDL47823.1| preprotein translocase, YajC subunit [Erythrobacter sp. SD-21]
          Length = 108

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                 +  +  V++FL+IRPQ +Q +   E +  L+RGD +VTA G+VGK+ +V ++  
Sbjct: 18  WLQILPWVAIFAVFWFLMIRPQMRQQKAHREKVDGLKRGDEVVTAGGLVGKITKV-EEQF 76

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           +E+E+ + ++VR V+  + EV +
Sbjct: 77  VELELTKGMKVRAVKHTIGEVLN 99


>gi|303256880|ref|ZP_07342894.1| preprotein translocase, YajC subunit [Burkholderiales bacterium
           1_1_47]
 gi|330998871|ref|ZP_08322598.1| preprotein translocase, YajC subunit [Parasutterella
           excrementihominis YIT 11859]
 gi|302860371|gb|EFL83448.1| preprotein translocase, YajC subunit [Burkholderiales bacterium
           1_1_47]
 gi|329576085|gb|EGG57604.1| preprotein translocase, YajC subunit [Parasutterella
           excrementihominis YIT 11859]
          Length = 116

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 50/98 (51%), Gaps = 5/98 (5%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                 S     G+  ++  V++FLLIRPQ+++ +   +M+ +L  G+ ++TA GI GK+
Sbjct: 17  QPGGLESMFSSFGVMILIFAVFWFLLIRPQQKRQKEHKKMIDSLTTGNEVITAGGICGKI 76

Query: 73  VRVIDDLELEVEIA----ENVRVRVVRSFVSEVQSKSE 106
           V   D+  + ++IA    + V +   R  +  V  K  
Sbjct: 77  VAA-DENYINLQIAAVDDKPVVITFQRVAIQAVLPKGT 113


>gi|270296237|ref|ZP_06202437.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270273641|gb|EFA19503.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 111

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 10 DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
           AP    A     M  +   + V+ YF +IRPQ ++ +  A   ++L+    ++TA GI 
Sbjct: 10 QAPVAGPAGGGSMMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQKVITAGGIH 69

Query: 70 GKVVRVIDDLELEVEIAENVRVRVVRSFV 98
          G V++ I+D ++ +EIA NV++R+ ++ +
Sbjct: 70 G-VIKEINDNDVVLEIASNVKIRIDKNSI 97


>gi|261405413|ref|YP_003241654.1| preprotein translocase subunit YajC [Paenibacillus sp. Y412MC10]
 gi|261281876|gb|ACX63847.1| preprotein translocase, YajC subunit [Paenibacillus sp. Y412MC10]
          Length = 102

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A A       L +   F ++ V++YFLLIRPQ+++ + R  ML  L +GD +VT  G+ G
Sbjct: 8   AAAQGQGGGILGLILPFVLMFVIFYFLLIRPQQKKQKTRNAMLSALSKGDKVVTIGGLHG 67

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
            +V + DD  + +++ +  ++   R+ VS 
Sbjct: 68  TIVEITDD-IVVLKVNDVTKLTFDRNSVSH 96


>gi|197118811|ref|YP_002139238.1| preprotein translocase subunit YajC [Geobacter bemidjiensis Bem]
 gi|197088171|gb|ACH39442.1| preprotein translocase, YajC subunit [Geobacter bemidjiensis Bem]
          Length = 106

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             +  +       +  ++YFLLIRPQ+++ +    +L  L++GD +VTA G+ GKV  + 
Sbjct: 20  MMAQFQGLIPLVFMFAIFYFLLIRPQQKKAKEHRALLDALKKGDQVVTAGGMHGKVTAL- 78

Query: 77  DDLELEVEIAENVRVRVVRSFVSEV 101
           DD  + +EIA  V VR+ + +++ +
Sbjct: 79  DDQVVTLEIAPGVNVRINKGYIASI 103


>gi|77164686|ref|YP_343211.1| preprotein translocase subunit, YajC [Nitrosococcus oceani ATCC
           19707]
 gi|254433388|ref|ZP_05046896.1| preprotein translocase, YajC subunit [Nitrosococcus oceani AFC27]
 gi|76883000|gb|ABA57681.1| protein translocase subunit yajC [Nitrosococcus oceani ATCC 19707]
 gi|207089721|gb|EDZ66992.1| preprotein translocase, YajC subunit [Nitrosococcus oceani AFC27]
          Length = 111

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 56/105 (53%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
               +AQ   P             +F  + +V+Y L IRP+ ++ + R  ML ++ +GD 
Sbjct: 5   IADAWAQGGPPPGA-PGDFWVPLLIFSTIFLVYYLLAIRPRLKRHKERLRMLASVNKGDE 63

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           I+T  G++G++++V  D  L +E++E + V+V +S VS V  K  
Sbjct: 64  IITNGGLLGRILQV-GDNFLLLELSEGMEVKVEKSAVSRVVPKGT 107


>gi|152991209|ref|YP_001356931.1| preprotein translocase subunit YajC [Nitratiruptor sp. SB155-2]
 gi|151423070|dbj|BAF70574.1| preprotein translocase subunit YajC [Nitratiruptor sp. SB155-2]
          Length = 91

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 56/90 (62%), Gaps = 1/90 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
                + L       ++  ++YFL+IRPQ+QQ ++  EM+ NL++GD IVT+ GI+ +VV
Sbjct: 2   QQQGANILGSLLPLIIIFAIFYFLIIRPQQQQAKKHKEMVNNLKKGDKIVTSGGIIAEVV 61

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           +  +D  ++ +I +N  V++ +SF+++   
Sbjct: 62  KNEEDF-IKAKIDDNTEVKIDKSFIAKKLK 90


>gi|325679266|ref|ZP_08158853.1| preprotein translocase, YajC subunit [Ruminococcus albus 8]
 gi|324109052|gb|EGC03281.1| preprotein translocase, YajC subunit [Ruminococcus albus 8]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 54/95 (56%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           + A    +A+S +       ++ V +YF +I+PQ++Q ++  EM  +L  GD I+T  GI
Sbjct: 11  TAAGQAPTASSYIMTFVPLALILVFFYFFIIKPQKKQEKQDREMRDSLEIGDEIITNGGI 70

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           VG V ++ DD  +     +  ++RV++  +++V S
Sbjct: 71  VGIVTQIKDDTVVVETGGDRSKIRVMKWAIAKVVS 105


>gi|289208482|ref|YP_003460548.1| preprotein translocase, YajC subunit [Thioalkalivibrio sp. K90mix]
 gi|288944113|gb|ADC71812.1| preprotein translocase, YajC subunit [Thioalkalivibrio sp. K90mix]
          Length = 109

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +E   +  +   + YFL+IRPQ ++ +    M+ +L +GD IVT  G+ G +  +  D 
Sbjct: 20  MIEFLIMILIFFAIMYFLIIRPQSKRAKEHRSMVESLSKGDEIVTNGGVAGTITEL-GDN 78

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++V+IA  V + V +  V +V  K  
Sbjct: 79  FIKVDIANGVNIAVQKQSVQQVMPKGT 105


>gi|325104802|ref|YP_004274456.1| protein translocase subunit yajC [Pedobacter saltans DSM 12145]
 gi|324973650|gb|ADY52634.1| protein translocase subunit yajC [Pedobacter saltans DSM 12145]
          Length = 100

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
            A+  +       ++ VV+YF +IRPQ ++ +   + +  L++GD ++T AGI G++V +
Sbjct: 9   QASGGVMSFLPMLLIIVVFYFFMIRPQMKKAKDHKKFVAELKKGDKVITTAGIHGRIVDL 68

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +   + +E     ++R  +S VS   SK 
Sbjct: 69  NE-TTIVLETEGGGKIRFDKSAVSLDASKG 97


>gi|157827232|ref|YP_001496296.1| preprotein translocase subunit YajC [Rickettsia bellii OSU 85-389]
 gi|157802536|gb|ABV79259.1| preprotein translocase subunit YajC [Rickettsia bellii OSU 85-389]
          Length = 146

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 63/96 (65%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+ FLL+RPQ+++ + R +++  +++G+ ++T +GI G V 
Sbjct: 29  TNSLQSGLTSLIPMVLIFAVFCFLLLRPQKKRRKEREKLVSEVKKGEEVLTNSGIYGIVT 88

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V + +  +EVEIA++VR++V++S + ++ S+S+ V
Sbjct: 89  KVSESEPNIEVEIAKDVRIKVLKSAIVDITSRSKDV 124


>gi|294501377|ref|YP_003565077.1| preprotein translocase subunit YajC [Bacillus megaterium QM B1551]
 gi|295706724|ref|YP_003599799.1| preprotein translocase subunit YajC [Bacillus megaterium DSM 319]
 gi|294351314|gb|ADE71643.1| preprotein translocase, YajC subunit [Bacillus megaterium QM B1551]
 gi|294804383|gb|ADF41449.1| preprotein translocase, YajC subunit [Bacillus megaterium DSM 319]
          Length = 87

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L+      ++ V++YFLLIRPQ+++ +   +M   L++GD +VT  G+ G V  + D
Sbjct: 1   MGVLQNIWPLLLMFVIFYFLLIRPQQKRQKNVQQMQSALKKGDKVVTIGGMHGLVDAI-D 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           + ++ V   +  ++   R+ + EV+S
Sbjct: 60  ESQVVVRSTDGSKLTFDRNAIREVRS 85


>gi|331701284|ref|YP_004398243.1| preprotein translocase subunit YajC [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128627|gb|AEB73180.1| preprotein translocase, YajC subunit [Lactobacillus buchneri NRRL
           B-30929]
          Length = 135

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 40/82 (48%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
                 +  VL  V YFL+IRPQR+Q Q+R + L  ++ GD ++T   + G V  + +  
Sbjct: 4   SYYSILMIVVLFAVMYFLMIRPQRKQQQKRRDQLSKIKEGDQVITIGRLHGVVDEINEAE 63

Query: 80  ELEVEIAENVRVRVVRSFVSEV 101
           +      + + +    S ++ V
Sbjct: 64  KTVTLDCDGIYLVFDLSAIASV 85


>gi|312897344|ref|ZP_07756770.1| preprotein translocase, YajC subunit [Megasphaera micronuciformis
           F0359]
 gi|310621562|gb|EFQ05096.1| preprotein translocase, YajC subunit [Megasphaera micronuciformis
           F0359]
          Length = 90

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           ++      ++ V++YF+L RPQ++Q +RR EML +++ G  ++T  GI G +V + +D  
Sbjct: 4   MQSFAPIILMVVIFYFMLWRPQKKQQKRRQEMLNSMKTGAKVITIGGIYGTIVELHED-Y 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
             + IAE   V++ R  +S+V  K E
Sbjct: 63  AMLRIAEKTEVKITRQSISQVLGKKE 88


>gi|189462538|ref|ZP_03011323.1| hypothetical protein BACCOP_03228 [Bacteroides coprocola DSM
          17136]
 gi|189430699|gb|EDU99683.1| hypothetical protein BACCOP_03228 [Bacteroides coprocola DSM
          17136]
          Length = 102

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                       +   +  + YF +IRPQ ++ +  A   +NL  G S++TA GI GK+
Sbjct: 9  QAAGGGGDYSFLIMMVAIFAIMYFFMIRPQNKKQKEIANFRKNLEVGQSVITAGGIYGKI 68

Query: 73 VRVIDDLELEVEIAENVRVRVVRSFV 98
            + +D  + VEIA +V+++V ++ +
Sbjct: 69 KEI-EDNTVIVEIASSVKIKVDKNSI 93


>gi|226954462|ref|ZP_03824926.1| IISP family preprotein translocase [Acinetobacter sp. ATCC 27244]
 gi|294651478|ref|ZP_06728791.1| preprotein translocase subunit YajC [Acinetobacter haemolyticus
           ATCC 19194]
 gi|226834811|gb|EEH67194.1| IISP family preprotein translocase [Acinetobacter sp. ATCC 27244]
 gi|292822628|gb|EFF81518.1| preprotein translocase subunit YajC [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 109

 Score = 90.2 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S +    +  V   ++YFL+ RPQ ++ +    ++ +L  G  IV A G++GK++R+
Sbjct: 16  QGPSLMANLLMIAVFVAIFYFLIWRPQAKRAKEHRSLVESLGVGSEIVFAGGLMGKIIRL 75

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D    VE++  V V++ R+ V  V  +  
Sbjct: 76  DGDFA-TVELSRGVEVKIQRASVISVLPEGT 105


>gi|188583934|ref|YP_001927379.1| preprotein translocase, YajC subunit [Methylobacterium populi
           BJ001]
 gi|179347432|gb|ACB82844.1| preprotein translocase, YajC subunit [Methylobacterium populi
           BJ001]
          Length = 110

 Score = 90.2 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 64/87 (73%), Gaps = 1/87 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-LEL 81
               F ++ V+ YFL++RPQ+++L+    M++N+RR D+IVT  G+VG+V +V D+  E+
Sbjct: 21  QFVPFVLIFVIMYFLILRPQQRRLKDHQSMVKNVRREDTIVTNGGLVGRVTKVADEASEI 80

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEPV 108
           EVEIA NVRV+VVRS +SEV+ K  PV
Sbjct: 81  EVEIAPNVRVKVVRSMISEVRVKGAPV 107


>gi|288803705|ref|ZP_06409134.1| preprotein translocase, YajC subunit [Prevotella melaninogenica
          D18]
 gi|288333794|gb|EFC72240.1| preprotein translocase, YajC subunit [Prevotella melaninogenica
          D18]
          Length = 109

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 11 APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
          A       SP+ M  +   +  + +F +IRPQ+++ +        L  GDS+VT  GI G
Sbjct: 8  AAQAAGQGSPMPMIIMMVAIFAIMWFFMIRPQQKKQKEIRAFQNALSAGDSVVTGGGIYG 67

Query: 71 KVVRVI-DDLELEVEIAENVRVRVVRSFV 98
           V  +     ++EVEIA  V + V +++V
Sbjct: 68 TVKHIDMTTNKVEVEIARGVVITVDKNYV 96


>gi|110634148|ref|YP_674356.1| protein translocase subunit yajC [Mesorhizobium sp. BNC1]
 gi|110285132|gb|ABG63191.1| protein translocase subunit yajC [Chelativorans sp. BNC1]
          Length = 111

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/90 (47%), Positives = 65/90 (72%), Gaps = 1/90 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L     F ++ V+ YFL+IRPQRQQ+++RAEML N+RRGD++VT  G+VGKV +VI+
Sbjct: 15  PDMLISILPFVLIFVIMYFLIIRPQRQQMKKRAEMLANVRRGDTVVTGGGLVGKVTKVIN 74

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           D ELE+++    +V  +RS +++V+ K EP
Sbjct: 75  DSELEIDLG-GTKVTALRSMLADVRVKGEP 103


>gi|56552794|ref|YP_163633.1| preprotein translocase subunit YajC [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241762468|ref|ZP_04760545.1| preprotein translocase, YajC subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753480|ref|YP_003226373.1| preprotein translocase, YajC subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56544368|gb|AAV90522.1| preprotein translocase, YajC subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241372970|gb|EER62637.1| preprotein translocase, YajC subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552843|gb|ACV75789.1| preprotein translocase, YajC subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 115

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 66/106 (62%), Gaps = 4/106 (3%)

Query: 1   MFT-TVYAQSDAPAIT--SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           MF+   +AQ+   +      +  L     F V+ ++ Y +LIRPQ+++ + +   +  ++
Sbjct: 1   MFSTPAFAQTAGNSAGLNGFSGQLLSMLPFLVVFLIIYLMLIRPQQKRFKDQRRAIDAVQ 60

Query: 58  RGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           +GD+++TA GI+GKV++V  D E+E+EI++ +++ VV++ +  VQ 
Sbjct: 61  KGDTVITAGGIIGKVLKVS-DREVEIEISKGIKISVVKATLQSVQP 105


>gi|149926690|ref|ZP_01914950.1| putative secreted protein [Limnobacter sp. MED105]
 gi|149824619|gb|EDM83835.1| putative secreted protein [Limnobacter sp. MED105]
          Length = 113

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S L       ++  V YFL IRPQ ++ +    M+  L++GD ++ + G++GK+ ++
Sbjct: 15  GPESGLLSFLPLILMFGVLYFLAIRPQMKRQKEHKAMVEALQKGDEVIASGGLLGKISKI 74

Query: 76  IDDLELEVEIAEN----VRVRVVRSFVSEVQSKSE 106
            +   + +E+AE     V V + R+ V  +  +  
Sbjct: 75  NE-SYITLEVAEMGDKPVEVVLQRAAVQSLLPRGT 108


>gi|29350000|ref|NP_813503.1| hypothetical protein BT_4592 [Bacteroides thetaiotaomicron
          VPI-5482]
 gi|253572754|ref|ZP_04850154.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|29341911|gb|AAO79697.1| conserved hypothetical protein with conserved domain [Bacteroides
          thetaiotaomicron VPI-5482]
 gi|251837654|gb|EES65745.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 105

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
             +A     M  +   + V+ YF +IRPQ ++ +  A   ++L+   S++TA GI G +
Sbjct: 9  QAPAAGGGSMMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQSVITAGGIHGTI 68

Query: 73 VRVIDDLELEVEIAENVRVRVVRSFV 98
            + DD  + +EIA NV++++ ++ +
Sbjct: 69 KEITDD-YIVLEIASNVKIKIDKNSI 93


>gi|302345745|ref|YP_003814098.1| preprotein translocase, YajC subunit [Prevotella melaninogenica
          ATCC 25845]
 gi|302150022|gb|ADK96284.1| preprotein translocase, YajC subunit [Prevotella melaninogenica
          ATCC 25845]
          Length = 109

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 11 APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
          A       SP+ M  +   +  + +F +IRPQ+++ +        L  GDS+VT  GI G
Sbjct: 8  AAQAAGQGSPMPMIIMMVAIFAIMWFFMIRPQQKKQKEIRAFQNALSAGDSVVTGGGIYG 67

Query: 71 KVVRVI-DDLELEVEIAENVRVRVVRSFV 98
           V  +     ++EVEIA  V + V +++V
Sbjct: 68 TVKHIDMTTNKVEVEIARGVVITVDKNYV 96


>gi|297182389|gb|ADI18554.1| preprotein translocase subunit yajc [uncultured gamma
           proteobacterium HF4000_23L14]
          Length = 90

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L        + V+ YFLLIRPQ+++ +    +L+ L++GD +VT  GIVGK+  V D+  
Sbjct: 3   LPPELFLVAMFVLLYFLLIRPQQKRAKDHKNLLKTLKKGDEVVTNGGIVGKINSV-DESF 61

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
             +E+AE V V+V +  +++   K 
Sbjct: 62  AALEVAEGVVVKVQKQGINQKMPKG 86


>gi|170748693|ref|YP_001754953.1| preprotein translocase, YajC subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655215|gb|ACB24270.1| preprotein translocase, YajC subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 110

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/85 (45%), Positives = 62/85 (72%), Gaps = 1/85 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL-EL 81
               F ++ V+ YFL++RPQ+++++    +L+++RR D++VT  G+VG+V +  DD  E+
Sbjct: 22  QVVPFVLIFVIMYFLILRPQQKRVKDHQALLKSVRRDDTVVTNGGLVGRVTKASDDQPEI 81

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSE 106
           EVEIA NVRVRVVRS +SEV++K  
Sbjct: 82  EVEIAPNVRVRVVRSMISEVRAKGT 106


>gi|113461457|ref|YP_719526.1| preprotein translocase subunit YajC [Haemophilus somnus 129PT]
 gi|112823500|gb|ABI25589.1| protein translocase subunit yajC [Haemophilus somnus 129PT]
          Length = 89

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI-DDLEL 81
           M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++T+ GI+GK+ ++  ++  +
Sbjct: 1   MLFIFAIFGLIFYFMIYRPQAKRNKAHKQLMSELAKGTEVLTSGGIIGKISKISAENDYV 60

Query: 82  EVEIAENVRVRVVRSFVSEVQSKS 105
            + + +   + + R F+  V  K 
Sbjct: 61  VIALNDTTEITIKRDFIVAVLPKG 84


>gi|227510193|ref|ZP_03940242.1| preprotein translocase subunit YajC [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227190398|gb|EEI70465.1| preprotein translocase subunit YajC [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 129

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 41/76 (53%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  VL  + YFL+IRPQ++Q Q+R + L  ++ GD +VT   + G +  + +  +     
Sbjct: 1   MIVVLFALMYFLMIRPQKKQQQKRRDQLSKIKPGDQVVTIGRLHGVIDEINEADKTVTLD 60

Query: 86  AENVRVRVVRSFVSEV 101
            + + +    S +++V
Sbjct: 61  CDGIYLVFDLSAIAQV 76


>gi|157964724|ref|YP_001499548.1| preprotein translocase subunit YajC [Rickettsia massiliae MTU5]
 gi|157844500|gb|ABV85001.1| Preprotein translocase YajC subunit [Rickettsia massiliae MTU5]
          Length = 166

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 61/96 (63%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+YFLL+RPQ  + + R +++  +++G+ ++T +GI G V 
Sbjct: 52  TNSLQSGLTSLIPMVLIFAVFYFLLLRPQETRRKEREKLVSEVKKGEEVLTNSGIYGIVT 111

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V + D  +E+EIA++VR++ ++S + ++ S+++ V
Sbjct: 112 KVSENDNNIEIEIAKDVRIKALKSAIIDITSRTKEV 147


>gi|227513121|ref|ZP_03943170.1| preprotein translocase subunit YajC [Lactobacillus buchneri ATCC
           11577]
 gi|227524336|ref|ZP_03954385.1| preprotein translocase subunit YajC [Lactobacillus hilgardii ATCC
           8290]
 gi|227083696|gb|EEI19008.1| preprotein translocase subunit YajC [Lactobacillus buchneri ATCC
           11577]
 gi|227088567|gb|EEI23879.1| preprotein translocase subunit YajC [Lactobacillus hilgardii ATCC
           8290]
          Length = 129

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 41/76 (53%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  VL  + YFL+IRPQ++Q Q+R + L  ++ GD +VT   + G +  + +  +     
Sbjct: 1   MIVVLFALMYFLMIRPQKKQQQKRRDQLSKIKPGDQVVTIGRLHGVIDEINEADKTVTLD 60

Query: 86  AENVRVRVVRSFVSEV 101
            + + +    S +++V
Sbjct: 61  CDGIYLVFDLSAIAQV 76


>gi|332877529|ref|ZP_08445276.1| preprotein translocase, YajC subunit [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332684635|gb|EGJ57485.1| preprotein translocase, YajC subunit [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 105

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                 + M  +   +  + YF +IRPQ ++ +   +   ++  G  +VTA GI GKV  
Sbjct: 9   QQQGGGMSMIIMMVAIFAIMYFFMIRPQNKKQKEIQKFRNSIVPGTDVVTAGGIYGKVKE 68

Query: 75  VID-DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           V + D  L VEIA  V++++ ++ V        
Sbjct: 69  VNELDNTLMVEIASGVKIKIAKNSVYAGVPTDT 101


>gi|323142294|ref|ZP_08077126.1| preprotein translocase, YajC subunit [Phascolarctobacterium sp.
          YIT 12067]
 gi|322413178|gb|EFY04065.1| preprotein translocase, YajC subunit [Phascolarctobacterium sp.
          YIT 12067]
          Length = 96

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                + L     FF++  ++YF+L +PQ+++ Q+R ++L +L+ GD I+T  GI GK+
Sbjct: 2  QGGDTMALLNSLWPFFLMGGIFYFMLWKPQKKEQQKRQDLLNSLKEGDEIITIGGIYGKI 61

Query: 73 VRVIDDLELEVEIAENVRVRVVRSFVS 99
            + +   ++VE+AE V + + R+ VS
Sbjct: 62 TAISE-KRVKVEVAEGVVIEMARNAVS 87


>gi|153004189|ref|YP_001378514.1| preprotein translocase subunit YajC [Anaeromyxobacter sp.
          Fw109-5]
 gi|152027762|gb|ABS25530.1| preprotein translocase, YajC subunit [Anaeromyxobacter sp.
          Fw109-5]
          Length = 116

 Score = 89.4 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 53/91 (58%), Gaps = 1/91 (1%)

Query: 9  SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
          S       A +P+     F ++AVV+YF+  RPQ +Q ++    L  L++GD +VT  GI
Sbjct: 10 SQTAPEGQAQNPIMGFLPFILIAVVFYFVFFRPQAKQAKKHQSFLSELKKGDEVVTQGGI 69

Query: 69 VGKVVRVIDDLELEVEIAENVRVRVVRSFVS 99
          +G VV V +D  + V++    +++++++ ++
Sbjct: 70 IGTVVLV-EDRTVLVDVGGGTKLKILKAQIA 99


>gi|255321487|ref|ZP_05362645.1| preprotein translocase, YajC subunit [Campylobacter showae RM3277]
 gi|255301343|gb|EET80602.1| preprotein translocase, YajC subunit [Campylobacter showae RM3277]
          Length = 96

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 55/89 (61%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            + +       VL  ++YFL+IRPQ++Q +  A M+  L +GD I+T+ G++ +V++  +
Sbjct: 4   GNFVASLLPLVVLFAIFYFLVIRPQQKQQKAHAAMIAALEKGDKIITSGGLICEVIK-PE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + V++ ++V VRV R F++    K+E
Sbjct: 63  DDFIRVKLNDDVIVRVSREFIARKIEKTE 91


>gi|74318096|ref|YP_315836.1| protein translocase subunit yajC [Thiobacillus denitrificans ATCC
           25259]
 gi|74057591|gb|AAZ98031.1| preprotein translocase protein YajC [Thiobacillus denitrificans
           ATCC 25259]
          Length = 106

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +       ++ ++++F+LIRPQ ++ + + +ML  L +GD +VTA+G VGK+ ++  D 
Sbjct: 17  GIADFLPLIIIFILFWFMLIRPQMKRTKEQKKMLSELAKGDEVVTASGQVGKIAKI-GDQ 75

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +EIA+ V V V +  V  +  K  
Sbjct: 76  YVSLEIADGVVVHVQKQSVQTLLPKGT 102


>gi|149279329|ref|ZP_01885460.1| YajC [Pedobacter sp. BAL39]
 gi|149229855|gb|EDM35243.1| YajC [Pedobacter sp. BAL39]
          Length = 113

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 55/99 (55%), Gaps = 7/99 (7%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M +TV  Q+         S +       ++ VV+YF +IRPQ ++ +   +++ +L++GD
Sbjct: 1  MISTVILQA------GGGSMVSTLIPMVLIMVVFYFFMIRPQVKKAKDHKKLVEDLKKGD 54

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVS 99
           IVT AGI G++V + +   L +E+    ++R  ++ +S
Sbjct: 55 KIVTTAGIHGRIVDMNETTFL-IEVEGGTKIRFDKTAIS 92


>gi|72162491|ref|YP_290148.1| protein translocase subunit yajC [Thermobifida fusca YX]
 gi|71916223|gb|AAZ56125.1| protein translocase subunit yajC [Thermobifida fusca YX]
          Length = 102

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 57/95 (60%), Gaps = 1/95 (1%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           ++          +    +F ++ VV+Y L IRPQ+++ Q+  EM ++L+ G  ++T AGI
Sbjct: 8   AEQQPQNQGAGLISQLLMFALIIVVFYLLFIRPQQKRRQQELEMQKSLQPGMEVLTGAGI 67

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            G +V V DD  +E+EI+   RVR+V++ V+ + S
Sbjct: 68  YGTIVEVHDDD-VELEISPGTRVRMVKAAVARIVS 101


>gi|283850330|ref|ZP_06367619.1| preprotein translocase, YajC subunit [Desulfovibrio sp. FW1012B]
 gi|283574356|gb|EFC22327.1| preprotein translocase, YajC subunit [Desulfovibrio sp. FW1012B]
          Length = 125

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 54/81 (66%), Gaps = 1/81 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           +P+       ++  ++YFLLIRPQ+++ ++  E L  L+RGDSI++  GI G+++ V  D
Sbjct: 22  NPITAFLPLILMFAIFYFLLIRPQQKKAKQHREYLAGLKRGDSILSGGGIYGRIMEVHGD 81

Query: 79  LELEVEIAENVRVRVVRSFVS 99
             L VEIA+++ + + RS+VS
Sbjct: 82  -RLTVEIAKDLTIEINRSYVS 101


>gi|307719627|ref|YP_003875159.1| preprotein translocase, YajC subunit [Spirochaeta thermophila DSM
           6192]
 gi|306533352|gb|ADN02886.1| preprotein translocase, YajC subunit [Spirochaeta thermophila DSM
           6192]
          Length = 118

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            A   +++   +     F ++ +++YFL+IRPQ ++ +   +ML +L +GD +VT  GI 
Sbjct: 17  GAQGASTSGQMMVTLITFGLIFLIFYFLIIRPQNKRQKEVQQMLASLDKGDEVVTIGGIH 76

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           G V  V +D  + +++ ++  + + +S ++ 
Sbjct: 77  GVVQSVKEDS-VVIKVDDHTTLLMEKSAIAR 106


>gi|51473764|ref|YP_067521.1| preprotein translocase subunit YajC [Rickettsia typhi str.
           Wilmington]
 gi|81390024|sp|Q68WF3|Y574_RICTY RecName: Full=UPF0092 membrane protein RT0574
 gi|51460076|gb|AAU04039.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 142

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+YFLL+RPQ Q+ + R +++R +++G+ ++T +GI G V 
Sbjct: 28  TNSLQSGLTSLIPMILIFAVFYFLLLRPQEQRRKEREKLVREVKKGEEVLTNSGIYGIVT 87

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +V + D  +E+EIA++VR++ ++S + ++ S+ + V
Sbjct: 88  KVSENDNNIEIEIAKDVRIKAIKSSIIDITSRKKEV 123


>gi|119713612|gb|ABL97663.1| preprotein translocase YajC subunit [uncultured marine bacterium
           EB0_39H12]
          Length = 97

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
               L F   ++ YFL+IRP+ ++ +   EML ++  G+ IVTA GI+GKV ++  D  L
Sbjct: 10  PTLFLLFGFMILIYFLMIRPENKRRKTHQEMLASIEVGEEIVTAGGILGKVSKIS-DQYL 68

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSE 106
           E+ I+E+ +++V ++ +S V  K  
Sbjct: 69  ELSISEDTKIKVQKTSISAVLPKGT 93


>gi|220905192|ref|YP_002480504.1| preprotein translocase subunit YajC [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869491|gb|ACL49826.1| preprotein translocase, YajC subunit [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 111

 Score = 89.4 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 59/107 (55%), Gaps = 6/107 (5%)

Query: 1   MF-TTVYAQSDAPAITSAT---SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNL 56
           MF +  YA     A  +       L       V+ V+++FLLIRPQ+++ +    ML  L
Sbjct: 1   MFESVAYAMGTPQAGGAPAGGADMLMQFLPLIVMFVIFWFLLIRPQQKRAKAHKLMLSEL 60

Query: 57  RRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           +RGD ++T++G++G+++ + DD ++ +E  E  ++RV R  +  +  
Sbjct: 61  KRGDHVLTSSGLIGRILEI-DDEQVLLECGE-AKLRVTRGAIGGLVP 105


>gi|8886049|gb|AAF80361.1|AF157831_3 YajC homolog [Bartonella bacilliformis]
          Length = 152

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 1/84 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-LELEVE 84
           L+    V+ YFL+IRPQR Q+++R EML  +RRGD IVT  GI+GKV++V D+  ELEVE
Sbjct: 20  LYSFYFVIMYFLIIRPQRVQMKKRQEMLNAVRRGDVIVTGGGIIGKVIKVHDEIGELEVE 79

Query: 85  IAENVRVRVVRSFVSEVQSKSEPV 108
           I E++ +R++RS +++V+ K EPV
Sbjct: 80  IGEDMHIRILRSTLADVRVKGEPV 103


>gi|221310708|ref|ZP_03592555.1| preprotein translocase subunit YajC [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315032|ref|ZP_03596837.1| preprotein translocase subunit YajC [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319953|ref|ZP_03601247.1| preprotein translocase subunit YajC [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324234|ref|ZP_03605528.1| preprotein translocase subunit YajC [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767632|ref|NP_390648.2| preprotein translocase subunit YajC [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321312298|ref|YP_004204585.1| preprotein translocase subunit YajC [Bacillus subtilis BSn5]
 gi|225185260|emb|CAB14730.2| conserved hypothetical protein [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|320018572|gb|ADV93558.1| preprotein translocase subunit YajC [Bacillus subtilis BSn5]
          Length = 88

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            T  L       ++  V YFLLIRPQ++Q +   +M   L++GDS+VT  G+ G V  + 
Sbjct: 1   MTGTLGTLVPIILMFAVLYFLLIRPQQKQQKAVRQMQEELKKGDSVVTIGGLHGTVDSI- 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEV 101
           D+ ++ ++  +N R+   R  + EV
Sbjct: 60  DESKVVIKTGDNTRLTFDRRAIREV 84


>gi|154148979|ref|YP_001406065.1| preprotein translocase subunit YajC [Campylobacter hominis ATCC
           BAA-381]
 gi|153804988|gb|ABS51995.1| preprotein translocase, YajC subunit [Campylobacter hominis ATCC
           BAA-381]
          Length = 90

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 47/87 (54%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S L       VL  ++YFLLIRPQ++Q +    M+  L +GD +VT  G    VV+V
Sbjct: 2   QQGSVLGSLLPLIVLFAIFYFLLIRPQQKQAKAHKAMIDALAKGDKLVTNGGFKATVVKV 61

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQ 102
            +   + V++ ++  V + R+FV++  
Sbjct: 62  AEGDFITVKLNDDTIVELDRNFVAKKI 88


>gi|212638561|ref|YP_002315081.1| preprotein translocase subunit YajC [Anoxybacillus flavithermus
           WK1]
 gi|212560041|gb|ACJ33096.1| Preprotein translocase subunit YajC [Anoxybacillus flavithermus
           WK1]
          Length = 87

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       +   ++YFLLIRPQ+++ +   +M  NL++GD ++T  G+ G ++  +D+  
Sbjct: 4   VASLLPLILFFAIFYFLLIRPQQKRQKAVQQMQANLQKGDKVITIGGLHG-IIDSLDENT 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQSK 104
           + +   +  R+   R+ + EV ++
Sbjct: 63  VVIRAGDGSRLTYDRAAIREVVNE 86


>gi|114777996|ref|ZP_01452896.1| preprotein translocase, YajC subunit [Mariprofundus ferrooxydans
           PV-1]
 gi|114551602|gb|EAU54155.1| preprotein translocase, YajC subunit [Mariprofundus ferrooxydans
           PV-1]
          Length = 93

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       ++ V++YFLL+RPQ+++++    ++  L++GD ++T  G  G VV V DD  
Sbjct: 12  IASLLPLALIMVIFYFLLVRPQQKKVKEHRTIIEALKKGDKVITGGGFYGTVVDVKDDF- 70

Query: 81  LEVEIAENVRVRVVRSFVSEV 101
           L+VEIAENVRV++ R  ++ +
Sbjct: 71  LKVEIAENVRVKIKRDTITGL 91


>gi|295698403|ref|YP_003603058.1| preprotein translocase, YajC subunit [Candidatus Riesia
           pediculicola USDA]
 gi|291157183|gb|ADD79628.1| preprotein translocase, YajC subunit [Candidatus Riesia
           pediculicola USDA]
          Length = 114

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 1   MFTTVYAQSDAPAIT---SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           M    +  S   +        SP  +  +  + A+++Y  + RPQ+++ +   +++ ++ 
Sbjct: 1   MIVKYFIDSAYASTNLHHEKDSPYSLVAMLVLFAIIFYLSIFRPQQKKAKEHKKLMDSIT 60

Query: 58  RGDSIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
            GD I+T  G++GKV R   +   L V + ++ ++ + R+F++ +  K  
Sbjct: 61  SGDEIITKGGLIGKVDRTHKNSDYLVVMLNDSNKILLHRNFITSILPKGT 110


>gi|288926809|ref|ZP_06420718.1| preprotein translocase, YajC subunit [Prevotella buccae D17]
 gi|288336438|gb|EFC74815.1| preprotein translocase, YajC subunit [Prevotella buccae D17]
          Length = 104

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 11 APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
          A         +    +   +  + +F ++RPQ+++ +       +L+ G  +VT  G+ G
Sbjct: 7  AAQAAQGGGSMTFLIMMIAIFAIMWFFMMRPQQKRQKEIRNFQNSLQNGTEVVTQGGVHG 66

Query: 71 KVVRVI-DDLELEVEIAENVRVRVVRSFV 98
           V  +  +   +EVEIA  V + V ++ V
Sbjct: 67 TVKSIDLNTNTVEVEIARGVIITVEKNCV 95


>gi|330995944|ref|ZP_08319839.1| preprotein translocase, YajC subunit [Paraprevotella xylaniphila
          YIT 11841]
 gi|329574283|gb|EGG55858.1| preprotein translocase, YajC subunit [Paraprevotella xylaniphila
          YIT 11841]
          Length = 105

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 15 TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                + M  +   +  + YF +IRPQ ++ +   +   ++  G  +VTA GI GKV  
Sbjct: 9  QQQGGGMSMIIMMVAIFAIMYFFMIRPQNKKQKEIQKFRNSIVPGTDVVTAGGIYGKVKE 68

Query: 75 VID-DLELEVEIAENVRVRVVRSFV 98
          V + D  L VEIA  V++++ ++ V
Sbjct: 69 VNELDNTLMVEIASGVKIKIAKNSV 93


>gi|71083671|ref|YP_266391.1| hypothetical protein SAR11_0979 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91763288|ref|ZP_01265252.1| YajC [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062784|gb|AAZ21787.1| YajC [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717701|gb|EAS84352.1| YajC [Candidatus Pelagibacter ubique HTCC1002]
          Length = 94

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 56/78 (71%)

Query: 20 PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
           +       ++ V++YF LIRPQ+++++    M+ NL RGD +VT+AGI+G V R+ID+ 
Sbjct: 4  GIGQFIPLILIFVIFYFFLIRPQQKKVKEHKAMVENLSRGDKVVTSAGIIGTVERIIDNE 63

Query: 80 ELEVEIAENVRVRVVRSF 97
          ++EV+IA+NV+V +++S 
Sbjct: 64 KVEVQIADNVKVEIIKST 81


>gi|15604436|ref|NP_220954.1| preprotein translocase subunit YajC [Rickettsia prowazekii str.
           Madrid E]
 gi|6648004|sp|Q9ZCW9|Y585_RICPR RecName: Full=UPF0092 membrane protein RP585
 gi|3861130|emb|CAA15030.1| unknown [Rickettsia prowazekii]
          Length = 142

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 58/92 (63%), Gaps = 1/92 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+YFLL+RPQ ++ + R +++  +++G+ ++  +GI G V 
Sbjct: 28  TNSLQSGLTSLIPMILIFAVFYFLLLRPQEKRRKEREKLVSGVKKGEEVLINSGIYGIVT 87

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSK 104
           +V + D  +E+EIA++VR++ ++S + ++ S+
Sbjct: 88  KVSENDNNIEIEIAKDVRIKAIKSAIVDITSR 119


>gi|291542714|emb|CBL15824.1| preprotein translocase, YajC subunit [Ruminococcus bromii L2-63]
          Length = 140

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 3/109 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           F  V A++ A     ++S + M   +  +    YF LIRP  ++ +  A++  +L  GD 
Sbjct: 4   FLPVVAEASASGGNQSSSMIFMILFYVAIFAALYFFLIRPNSKKKKEEAQLRNSLEIGDE 63

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEI-AENVRVRVVRSFVSEVQS-KSEP 107
           I T  GI+G+VV + DD   + +E  ++ V+++  +  +S V + K +P
Sbjct: 64  ITTIGGIMGRVVAIKDDEDAIIIETGSDRVKMKFKKWCISTVDTVKEQP 112


>gi|315634696|ref|ZP_07889980.1| preprotein translocase [Aggregatibacter segnis ATCC 33393]
 gi|315476644|gb|EFU67392.1| preprotein translocase [Aggregatibacter segnis ATCC 33393]
          Length = 99

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               SP+ M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++TA GI+GK+ +
Sbjct: 3   AQQGSPMSMLFIFIIFGLIFYFMIYRPQAKRNKEHKKLMSELTKGTEVLTAGGIIGKITK 62

Query: 75  VIDD-LELEVEIAENVRVRVVRSFVSEVQSKSE 106
           V+++   + + + ++  V + R++++ V  K  
Sbjct: 63  VVENSDSIVIALNDSTEVTINRNYIAAVLPKGT 95


>gi|152991989|ref|YP_001357710.1| preprotein translocase subunit YajC [Sulfurovum sp. NBC37-1]
 gi|151423850|dbj|BAF71353.1| preprotein translocase subunit YajC [Sulfurovum sp. NBC37-1]
          Length = 96

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
                S +       +L  ++YFL+IRPQ++Q++   EML +L +GD IVT+ G++  +V
Sbjct: 2   GAEQGSMIGSFLPLIILFAIFYFLIIRPQQKQVKAHKEMLTSLEKGDKIVTSGGLIATIV 61

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +V +D  +++++ ++  V++ +++V++     
Sbjct: 62  KVEEDF-IKIKLNDDTVVKLDKAYVAKKVETG 92


>gi|222100690|ref|YP_002535258.1| preprotein translocase, YajC subunit [Thermotoga neapolitana DSM
           4359]
 gi|221573080|gb|ACM23892.1| preprotein translocase, YajC subunit [Thermotoga neapolitana DSM
           4359]
          Length = 120

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 60/109 (55%), Gaps = 6/109 (5%)

Query: 1   MFTTVYAQSDAPAITSATSPLE-----MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRN 55
           M   +YA +   +  SAT+P       +  +      ++YFL+I PQR++ ++  +ML  
Sbjct: 8   MPEIIYAAAPGASNGSATAPASSGWGSLLFMLIFFIAIFYFLIILPQRRREKQFQQMLSQ 67

Query: 56  LRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
           L+RGD++VT  GIVGKV+ +  D  ++++ A    + + +  +S V  +
Sbjct: 68  LKRGDTVVTIGGIVGKVIDIKKD-TVKIKTANATELEITKRAISTVIKE 115


>gi|40063327|gb|AAR38145.1| preprotein translocase, YajC subunit [uncultured marine bacterium
           578]
          Length = 108

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L        + V+ YFLLIRPQ+++ +    +L+ L+ GD +VT  G++GK+  V D+  
Sbjct: 3   LPPELFLIAMFVLMYFLLIRPQQKRAKDHKNLLKELKTGDEVVTNGGVIGKINAV-DESF 61

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
            E+EIA  V V+V +  +++   K 
Sbjct: 62  AEIEIASGVFVKVQKQGINQKMPKG 86


>gi|311031513|ref|ZP_07709603.1| preprotein translocase subunit YajC [Bacillus sp. m3-13]
          Length = 87

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
                     ++  ++YFLLIRPQ+++ ++  EM  +L++GD +VT  G+ G +V  +D+
Sbjct: 3   GMAGAILPLVLMFAIFYFLLIRPQQKRQKQVREMQTSLQKGDKVVTIGGLHG-IVDALDE 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQ 102
            ++ ++  +  R+   R  V +V 
Sbjct: 62  DKIVIKAGDGSRLTYDRQAVRDVV 85


>gi|251793026|ref|YP_003007752.1| preprotein translocase subunit YajC [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534419|gb|ACS97665.1| preprotein translocase, YajC subunit [Aggregatibacter aphrophilus
           NJ8700]
          Length = 99

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               SP+ M  +F +  +++YF++ RPQ ++ +   +++  L +G  ++TA GI+GK+ +
Sbjct: 3   AQQGSPMSMLFIFIIFGLIFYFMIYRPQAKRNKEHKKLMSELTKGTEVLTAGGIIGKITK 62

Query: 75  VIDDLELEVE-IAENVRVRVVRSFVSEVQSKSE 106
           V +  ++ V  + +   + + R++++ V  K  
Sbjct: 63  VPEKGDVIVIALNDKTEITINRNYIAAVLPKGT 95


>gi|39997712|ref|NP_953663.1| preprotein translocase subunit YajC [Geobacter sulfurreducens PCA]
 gi|39984604|gb|AAR35990.1| preprotein translocase, YajC subunit [Geobacter sulfurreducens PCA]
 gi|298506646|gb|ADI85369.1| preprotein translocase, YajC subunit [Geobacter sulfurreducens
           KN400]
          Length = 106

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 55/104 (52%), Gaps = 4/104 (3%)

Query: 1   MFTTVYAQSDAPAITSATSP---LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           M    +A +  P    A       +       +  ++YFLLIRPQ+++ +    +L +L+
Sbjct: 1   MLGIAFAMAAPPGGAQAGGAMGAFQAILPLVFMFAIFYFLLIRPQQKKAKEHRALLDSLK 60

Query: 58  RGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           RGD +VTA G+ GKV  + D   + +EIA  V +++ + +V+ +
Sbjct: 61  RGDQVVTAGGMHGKVSGI-DGDIVNLEIAPGVVIKITKGYVASL 103


>gi|326801390|ref|YP_004319209.1| preprotein translocase, YajC subunit [Sphingobacterium sp. 21]
 gi|326552154|gb|ADZ80539.1| preprotein translocase, YajC subunit [Sphingobacterium sp. 21]
          Length = 115

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 9  SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
          + A  + + +  +    +  ++ VV+YF +IRPQ ++ +   + + +L+  D +VT AGI
Sbjct: 3  TAAILLQAGSGGMSSLIMMGLIVVVFYFFMIRPQMKKQKDHKKYIEDLKVNDKVVTTAGI 62

Query: 69 VGKVVRVIDDLELEVEIAENVRVRVVRSFVS 99
           G++V + +   + +++    R++  ++ +S
Sbjct: 63 HGRIVEISESTFI-IDVGSGTRIKFDKAAIS 92


>gi|296331685|ref|ZP_06874154.1| preprotein translocase subunit YajC [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675356|ref|YP_003867028.1| hypothetical protein BSUW23_13410 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151280|gb|EFG92160.1| preprotein translocase subunit YajC [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413600|gb|ADM38719.1| conserved hypothetical protein [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 88

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            T  L       ++  V YFLLIRPQ++Q +    M   L++GDS+VT  G+ G V  + 
Sbjct: 1   MTGTLGTLVPIILMFAVLYFLLIRPQQKQQKAVRRMQEELKKGDSVVTIGGLHGTVDSI- 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEV 101
           D+ ++ ++  EN R+   R  + EV
Sbjct: 60  DESKVVIKTGENTRLTFDRRAIREV 84


>gi|167750670|ref|ZP_02422797.1| hypothetical protein EUBSIR_01647 [Eubacterium siraeum DSM 15702]
 gi|167656349|gb|EDS00479.1| hypothetical protein EUBSIR_01647 [Eubacterium siraeum DSM 15702]
          Length = 118

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 56/94 (59%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A +         S L M     ++ V++YFL+IRP++++ ++  EML NL   D +VT  
Sbjct: 14  ATTTGQGGNDIVSILTMLIPLALMVVIFYFLIIRPEKKRGKKMQEMLNNLEVADEVVTTG 73

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           GIVG+V+RV DD  L    ++  ++RV++S ++E
Sbjct: 74  GIVGRVLRVTDDTVLIETGSDRTKIRVLKSSIAE 107


>gi|240949468|ref|ZP_04753808.1| preprotein translocase subunit YajC [Actinobacillus minor NM305]
 gi|240296041|gb|EER46702.1| preprotein translocase subunit YajC [Actinobacillus minor NM305]
          Length = 102

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S LEM  +  V  +++YF++ RPQ ++ + + E+L NL +GD I+T+ G++G++ +V
Sbjct: 2   QQGSGLEMLVILAVFGIIFYFMIYRPQAKRQKEQRELLSNLAKGDEILTSGGLIGRITKV 61

Query: 76  --IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
               +  +      N  V + R+FV     K  
Sbjct: 62  SAESENVVMALNDNNNEVMISRNFVVAKLPKGT 94


>gi|110638831|ref|YP_679040.1| protein translocase subunit yajC [Cytophaga hutchinsonii ATCC
           33406]
 gi|110281512|gb|ABG59698.1| protein translocase subunit yajC [Cytophaga hutchinsonii ATCC
           33406]
          Length = 101

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 48/93 (51%), Gaps = 1/93 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
               ++     G   V+  V+YF +IRPQ+++ + +     NL+ GD + T  G+ G + 
Sbjct: 10  QAQGSNNYLQFGFIAVMIAVFYFFMIRPQQKKAKEQETFRSNLKPGDKVQTIGGLHGTIA 69

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +  D  + + + + +R++  +S V  + +K+E
Sbjct: 70  SIESDGTIVLLV-DRIRMKFEKSAVQGLSTKAE 101


>gi|218885646|ref|YP_002434967.1| preprotein translocase subunit YajC [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756600|gb|ACL07499.1| preprotein translocase, YajC subunit [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 133

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 2/100 (2%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
              YA           +P+       ++  ++YFLLIRPQ+++ +    ML ++++GD++
Sbjct: 5   NVAYAMGAGQPAGGGANPIASFVPLILMFAIFYFLLIRPQQKKAKEHKAMLESIKKGDNV 64

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
           VTA GI  +V  V DD  + V      +VRV RSFVS V 
Sbjct: 65  VTAGGIYARVFEVQDD--VLVLDLGETKVRVGRSFVSAVI 102


>gi|325972708|ref|YP_004248899.1| preprotein translocase, YajC subunit [Spirochaeta sp. Buddy]
 gi|324027946|gb|ADY14705.1| preprotein translocase, YajC subunit [Spirochaeta sp. Buddy]
          Length = 149

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 59/107 (55%), Gaps = 4/107 (3%)

Query: 1   MFTTVYAQSDA---PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           M + + A +      A  +  S +     F ++ V++YFL+IRPQ+++ +   EML  ++
Sbjct: 1   MLSFLSAMAAPEASGAAGTTGSMMTTFVTFGLIIVIFYFLIIRPQKKRDKETKEMLAAIK 60

Query: 58  RGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
           +GD +V+  GI G VV V +   +  ++ +N R+   RS +S + ++
Sbjct: 61  KGDKVVSIGGIHGTVVAVKETTVVV-KVDDNTRLEFSRSAISSIVNR 106


>gi|291532013|emb|CBK97598.1| preprotein translocase, YajC subunit [Eubacterium siraeum 70/3]
 gi|291558248|emb|CBL35365.1| preprotein translocase, YajC subunit [Eubacterium siraeum V10Sc8a]
          Length = 118

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 56/94 (59%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A +         S L M     ++ V++YFL+IRP++++ ++  EML NL   D +VT  
Sbjct: 14  ATTTGQGGNDIVSILTMLIPLALMVVIFYFLIIRPEKKRGKKMQEMLNNLEVADEVVTTG 73

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           GIVG+V+RV DD  L    ++  ++RV++S ++E
Sbjct: 74  GIVGRVLRVTDDTVLIETGSDRTKIRVLKSSIAE 107


>gi|329120262|ref|ZP_08248930.1| preprotein translocase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327462603|gb|EGF08926.1| preprotein translocase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 143

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            S L       ++ V +Y L++RPQ+++ +    +L  L+ GD ++ ++GIVGK+ +  +
Sbjct: 58  PSALMQYAPLALILVFFYLLIMRPQQKKFKEHQNLLSELKPGDKVLLSSGIVGKITKTGE 117

Query: 78  DLELEVEIAENVRVRVVRSFVSE 100
                VEIA NV ++V R+ V+ 
Sbjct: 118 KFF-TVEIARNVEIQVERNAVAA 139


>gi|260591413|ref|ZP_05856871.1| preprotein translocase, YajC subunit [Prevotella veroralis F0319]
 gi|260536605|gb|EEX19222.1| preprotein translocase, YajC subunit [Prevotella veroralis F0319]
          Length = 109

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 7  AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
          A   A   T      +M  +  V+  + +FL+IRPQ+++ +        L+ GD++VT  
Sbjct: 4  AMFLAAQPTQGGGGWQMIVMMVVIFAIMWFLMIRPQQKKQKEIRAFQNALKAGDTVVTGG 63

Query: 67 GIVGKVVRVI-DDLELEVEIAENVRVRVVRSFV 98
          GI G V ++     ++++EIA NV + V + +V
Sbjct: 64 GIYGTVKKIDLATNKVDIEIAHNVVITVDKGYV 96


>gi|225849629|ref|YP_002729863.1| preprotein translocase, YajC subunit [Persephonella marina EX-H1]
 gi|225645025|gb|ACO03211.1| preprotein translocase, YajC subunit [Persephonella marina EX-H1]
          Length = 97

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 53/88 (60%), Gaps = 1/88 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                   +       +L  ++YFLL RPQ+QQ ++  E L+NL++G+ ++T+ GI+G++
Sbjct: 2   QGDPVGGLISAIIWMVLLIAIFYFLLYRPQQQQRKKHEEFLKNLKKGEKVITSGGIIGEI 61

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSE 100
             + D+  + ++I+E   ++V+++ +S 
Sbjct: 62  KSI-DEKTVSLKISEGTIIKVLKTAIST 88


>gi|83815060|ref|YP_444169.1| preprotein translocase, YajC subunit [Salinibacter ruber DSM 13855]
 gi|294505827|ref|YP_003569885.1| Preprotein translocase subunit YajC [Salinibacter ruber M8]
 gi|83756454|gb|ABC44567.1| preprotein translocase, YajC subunit [Salinibacter ruber DSM 13855]
 gi|294342155|emb|CBH22933.1| Preprotein translocase subunit YajC [Salinibacter ruber M8]
          Length = 111

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 47/86 (54%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           + +     ++  V+YF + RPQ+++ +   EM+ NL +GD IVT  G+ G + ++ +D  
Sbjct: 26  VGLLFPLVLIIGVFYFFIYRPQQKREEEHQEMVENLEQGDKIVTVGGVHGTIQKIDEDSV 85

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           L    ++  R+R  +  ++ + +  E
Sbjct: 86  LAQVNSKGTRLRFNKDSIASLANDEE 111


>gi|167762591|ref|ZP_02434718.1| hypothetical protein BACSTE_00947 [Bacteroides stercoris ATCC
          43183]
 gi|167699697|gb|EDS16276.1| hypothetical protein BACSTE_00947 [Bacteroides stercoris ATCC
          43183]
          Length = 109

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 53/98 (54%), Gaps = 5/98 (5%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          + T  + Q+ A     +     M  +   +  + YF +IRPQ ++ +  A   ++L+   
Sbjct: 3  LMTVFFLQAPAAGPDGS----MMWIMLIAMFAIMYFFMIRPQNKKQKEIANFRKSLQVNQ 58

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           ++TA GI G +++ I+D ++ +EIA NV++ + ++ +
Sbjct: 59 KVITAGGIHG-IIKEINDNDVVLEIASNVKIHIDKNSI 95


>gi|116748680|ref|YP_845367.1| preprotein translocase subunit YajC [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697744|gb|ABK16932.1| protein translocase subunit yajC [Syntrophobacter fumaroxidans
           MPOB]
          Length = 114

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
              ++  ++YFLLIRPQ+++ +    ML NL++ D ++T  G+ GK+  +  D    +EI
Sbjct: 31  PLIIMVAIFYFLLIRPQQKKQKEHRAMLGNLKKDDVVLTQGGLQGKITGLT-DTVATIEI 89

Query: 86  AENVRVRVVRSFVSEVQSKSE 106
           A+ VRV+V R +++ + SK E
Sbjct: 90  ADKVRVKVHRGYIAALISKGE 110


>gi|313637720|gb|EFS03088.1| preprotein translocase, YajC subunit [Listeria seeligeri FSL
           S4-171]
          Length = 98

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 29  VLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAEN 88
           ++ V++YFLLIRPQ+++ +    M  +L +GD I+T  G+ G +V  I+D  + ++   N
Sbjct: 1   MMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHG-IVEAIEDGTVILKCGNN 59

Query: 89  VRVRVVRSFVSEVQSKSEPV 108
            ++   R+ V  V  K + V
Sbjct: 60  -KLTFDRNAVRTVLEKGDAV 78


>gi|6648027|sp|O32052|YRBF_BACSU RecName: Full=UPF0092 membrane protein yrbF
 gi|6977809|emb|CAB75334.1| hypothetical protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|291485180|dbj|BAI86255.1| preprotein translocase subunit YajC [Bacillus subtilis subsp. natto
           BEST195]
          Length = 89

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            T  L       ++  V YFLLIRPQ++Q +   +M   L++GDS+VT  G+ G V  + 
Sbjct: 2   MTGTLGTLVPIILMFAVLYFLLIRPQQKQQKAVRQMQEELKKGDSVVTIGGLHGTVDSI- 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEV 101
           D+ ++ ++  +N R+   R  + EV
Sbjct: 61  DESKVVIKTGDNTRLTFDRRAIREV 85


>gi|205374304|ref|ZP_03227103.1| preprotein translocase YajC subunit [Bacillus coahuilensis m4-4]
          Length = 87

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            + L     F V+ +V+YFLLIRPQ+++ +   +M  NL++GD ++T  G+ GKV  VID
Sbjct: 1   MATLINLAPFLVMLLVFYFLLIRPQQKRQKAVQQMQSNLQKGDHVITIGGLHGKV-DVID 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEV 101
           +  + +   +  ++   R+ + EV
Sbjct: 60  EATVVIFSTDGSKLTFDRNAIREV 83


>gi|329955548|ref|ZP_08296456.1| preprotein translocase, YajC subunit [Bacteroides clarus YIT
          12056]
 gi|328525951|gb|EGF52975.1| preprotein translocase, YajC subunit [Bacteroides clarus YIT
          12056]
          Length = 109

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 54/98 (55%), Gaps = 5/98 (5%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          + T  + Q+ A     +     M  L   + V+ YF +IRPQ ++ +  A   ++L+   
Sbjct: 3  LMTVFFLQAPAAGPDGS----MMWILLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQ 58

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           ++TA GI G +++ I+D ++ +EIA NV++ + ++ +
Sbjct: 59 KVITAGGIHG-IIKEINDNDVVLEIASNVKIHIDKNSI 95


>gi|118580219|ref|YP_901469.1| preprotein translocase subunit YajC [Pelobacter propionicus DSM
           2379]
 gi|118502929|gb|ABK99411.1| protein translocase subunit yajC [Pelobacter propionicus DSM 2379]
          Length = 107

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 60/108 (55%), Gaps = 5/108 (4%)

Query: 1   MFTTVYAQSDAPAITSATSP----LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNL 56
           M    +A S  P   +         +      ++  ++YFLLIRPQ+++ +    +L ++
Sbjct: 1   MLGLAFAMSGPPGGATGAGGAAGAFQQFITLALMFAIFYFLLIRPQQKKAKEHRALLESI 60

Query: 57  RRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
           ++GD +VTA G+ GKV  V +D  + +EIA  V +++ +S+++ + +K
Sbjct: 61  KKGDQVVTAGGVHGKVASV-EDGIVGLEIATGVIIKITKSYIAAINNK 107


>gi|257457345|ref|ZP_05622516.1| preprotein translocase, YajC subunit [Treponema vincentii ATCC
           35580]
 gi|257445267|gb|EEV20339.1| preprotein translocase, YajC subunit [Treponema vincentii ATCC
           35580]
          Length = 145

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
              ++           ++ V++Y  +I PQ+++ ++  EM+ ++++GD ++T  GI G V
Sbjct: 8   QQAASGGSFIPLLALGLIFVIFYVFIIGPQKKEQKKTQEMIASVQKGDKVITIGGIHGVV 67

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
             V +   + +++ +N ++ + RS +  V 
Sbjct: 68  SSVKE-TTIILKVDDNCKLEMNRSAIGNVI 96


>gi|317476858|ref|ZP_07936101.1| preprotein translocase subunit [Bacteroides eggerthii 1_2_48FAA]
 gi|316907033|gb|EFV28744.1| preprotein translocase subunit [Bacteroides eggerthii 1_2_48FAA]
          Length = 109

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 53/98 (54%), Gaps = 5/98 (5%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          + T  + Q+ A     +     M  +   +  + YF +IRPQ ++ +  A   ++L+   
Sbjct: 3  LMTVFFLQAPAAGPDGS----MMWIMLIAMFAIMYFFMIRPQNKKQKEIANFRKSLQVNQ 58

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           ++TA GI G +++ I+D ++ +EIA NV++ + ++ +
Sbjct: 59 KVITAGGIHG-IIKEINDNDVVLEIASNVKIHIDKNSI 95


>gi|307822490|ref|ZP_07652721.1| preprotein translocase, YajC subunit [Methylobacter tundripaludum
           SV96]
 gi|307736094|gb|EFO06940.1| preprotein translocase, YajC subunit [Methylobacter tundripaludum
           SV96]
          Length = 116

 Score = 88.3 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
           S +  +E       + V +YFL +RPQ ++ + + EM+  + +G  +VT+ GI+GKVV +
Sbjct: 16  SQSPGIEGMLFPLGILVFFYFLFLRPQSKRAKEKKEMIAAMTKGSEVVTSGGILGKVVDL 75

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            DD  ++VEI +N  ++V R  +  +  K  
Sbjct: 76  -DDNFVKVEICDNTFIQVQRHSIESMMPKGT 105


>gi|188996095|ref|YP_001930346.1| preprotein translocase, YajC subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931162|gb|ACD65792.1| preprotein translocase, YajC subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 101

 Score = 88.3 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                   +       +   ++YFL++RPQ+QQ ++  E L+NL++GD ++T  GI+G++
Sbjct: 2   QGDPMGGLISAIVWMVLFVGIFYFLILRPQQQQRKKHEEFLKNLKKGDKVITTGGIIGEI 61

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSE 100
            + I++  + +++ E   ++V++  ++ 
Sbjct: 62  -KNIEEKTVSLKVCEGCIIKVLKPSIAS 88


>gi|138896154|ref|YP_001126607.1| preprotein translocase subunit YajC [Geobacillus
           thermodenitrificans NG80-2]
 gi|196250108|ref|ZP_03148802.1| preprotein translocase, YajC subunit [Geobacillus sp. G11MC16]
 gi|134267667|gb|ABO67862.1| Preprotein translocase YajC subunit [Geobacillus
           thermodenitrificans NG80-2]
 gi|196210292|gb|EDY05057.1| preprotein translocase, YajC subunit [Geobacillus sp. G11MC16]
          Length = 91

 Score = 88.3 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + +       +  V++YFLLIRPQ+++ +   +M  NL++GD IVT  G+ G +  V +D
Sbjct: 3   ATIANLLPIVLFFVIFYFLLIRPQQKRQRAVQQMQANLKKGDKIVTIGGLHGIIDSVDED 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSK 104
             + +   +  R+   RS V EV  K
Sbjct: 63  K-IIIRAGDGTRLTYDRSAVREVVGK 87


>gi|297529250|ref|YP_003670525.1| preprotein translocase, YajC subunit [Geobacillus sp. C56-T3]
 gi|297252502|gb|ADI25948.1| preprotein translocase, YajC subunit [Geobacillus sp. C56-T3]
          Length = 90

 Score = 88.3 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + +       +  V++YFLLIRPQ+++ +   +M  NL++GD I+T  G+ G +  V +D
Sbjct: 3   ATIANLLPIVLFFVIFYFLLIRPQQKRQRAIQQMQANLKKGDKIITIGGLHGIIDSVDED 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKS 105
             + V   +  R+   RS V EV ++S
Sbjct: 63  K-IIVRAGDGTRLTFDRSAVREVVAES 88


>gi|198277118|ref|ZP_03209649.1| hypothetical protein BACPLE_03326 [Bacteroides plebeius DSM
          17135]
 gi|198269616|gb|EDY93886.1| hypothetical protein BACPLE_03326 [Bacteroides plebeius DSM
          17135]
          Length = 102

 Score = 88.3 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 14 ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
               +      +   +  + YF +IRPQ ++ +  A   +NL  G S+VTA GI GK+ 
Sbjct: 9  QAQGGADYSFLIMMVAIFAIMYFFMIRPQNKKQKEIANFRKNLEVGQSVVTAGGIYGKIK 68

Query: 74 RVIDDLELEVEIAENVRVRVVRSFV 98
           + +D  + VE+A  V+++V ++ +
Sbjct: 69 EI-EDNTVIVEVAAGVKIKVDKNSI 92


>gi|163784092|ref|ZP_02179041.1| preprotein translocase subunit YajC [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880637|gb|EDP74192.1| preprotein translocase subunit YajC [Hydrogenivirga sp. 128-5-R1-1]
          Length = 91

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                 +       +L  ++YFLL RPQ+QQ ++  E L+NL++GD ++T+ G++G++  
Sbjct: 2   QGGEQIISAVIWMVLLIAIFYFLLYRPQQQQRKKHEEFLKNLKKGDKVITSGGLIGEIKS 61

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSE 100
           V ++  + ++I E   V+VV+  V+ 
Sbjct: 62  V-EENTVSLKICEGCIVKVVKPSVAS 86


>gi|254468979|ref|ZP_05082385.1| preprotein translocase, YajC subunit [beta proteobacterium KB13]
 gi|207087789|gb|EDZ65072.1| preprotein translocase, YajC subunit [beta proteobacterium KB13]
          Length = 104

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +  YA S       A   L     F ++ +++YF+LIRPQ +Q +   ++L  L++GD
Sbjct: 1   MISLAYANSA-----PAPGGLMSFVPFIIIFILFYFMLIRPQMKQAKEHKKLLSELKKGD 55

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            I+ A+GI+GK+ +V  D  + +EI+   ++ V ++ V  V +K  
Sbjct: 56  EIMLASGILGKIEKVT-DNFVILEISNGTQINVQKNSVQAVLNKGT 100


>gi|198283824|ref|YP_002220145.1| preprotein translocase subunit YajC [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667628|ref|YP_002426461.1| preprotein translocase, YajC subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248345|gb|ACH83938.1| preprotein translocase, YajC subunit [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519841|gb|ACK80427.1| preprotein translocase, YajC subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 111

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S          +  ++YFLLIRPQ ++ + + +++  + +GD ++T  G+ G++++  +D
Sbjct: 21  SFFIQVIPLVAIFAIFYFLLIRPQTKKAKEQRQLIATISKGDEVITQGGLAGRIMQAGED 80

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             L++E+AE V V+V R+ V+ +  K  
Sbjct: 81  -YLQLEVAEGVIVKVQRASVTLLLPKGT 107


>gi|299535654|ref|ZP_07048975.1| hypothetical protein BFZC1_06513 [Lysinibacillus fusiformis ZC1]
 gi|298728854|gb|EFI69408.1| hypothetical protein BFZC1_06513 [Lysinibacillus fusiformis ZC1]
          Length = 88

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++ V  +F+LIRP +++ Q    M  +L+RGD ++T  G+ G V+  I+
Sbjct: 1   MDQLLGLAPILLMFVAMWFILIRPAKKRQQETQNMQSSLQRGDKVITIGGLHG-VIDAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + ++IA+NVRV+  R  +  + + ++
Sbjct: 60  DTAVTLKIADNVRVKFDRQAIGRIVNDNQ 88


>gi|319901556|ref|YP_004161284.1| protein translocase subunit yajC [Bacteroides helcogenes P
          36-108]
 gi|319416587|gb|ADV43698.1| protein translocase subunit yajC [Bacteroides helcogenes P
          36-108]
          Length = 109

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 55/98 (56%), Gaps = 5/98 (5%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          + T  + Q+ A     +     M  +   + V+ YF +IRPQ ++ +  A   ++L+   
Sbjct: 3  LMTVFFLQAPAAGAGGS----MMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQ 58

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           ++TA GI G V++ I+D ++ +EIA NV++R+ ++ +
Sbjct: 59 KVITAGGIHG-VIKEINDNDIVLEIASNVKIRIDKNSI 95


>gi|325298377|ref|YP_004258294.1| preprotein translocase, YajC subunit [Bacteroides salanitronis
          DSM 18170]
 gi|324317930|gb|ADY35821.1| preprotein translocase, YajC subunit [Bacteroides salanitronis
          DSM 18170]
          Length = 102

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 14 ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
                      +   +  + YF +IRPQ ++ +      +NL  G S++TA GI GK+ 
Sbjct: 9  QAQGGGDYSFLIMMVAIFAIMYFFMIRPQNKKQKEIQNFRKNLEVGQSVITAGGIYGKIK 68

Query: 74 RVIDDLELEVEIAENVRVRVVRSFV 98
           + +D  + VEIA +V+++V ++ +
Sbjct: 69 EI-EDNAVIVEIAPSVKIKVDKNSI 92


>gi|218129921|ref|ZP_03458725.1| hypothetical protein BACEGG_01504 [Bacteroides eggerthii DSM
          20697]
 gi|217988031|gb|EEC54356.1| hypothetical protein BACEGG_01504 [Bacteroides eggerthii DSM
          20697]
          Length = 109

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 53/98 (54%), Gaps = 5/98 (5%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          + T  + Q+ A     +     M  +   +  + YF +IRPQ ++ +  A   ++L+   
Sbjct: 3  LMTVFFLQAPAAGPDGS----MMWIMLIAMFAIMYFFMIRPQNKKQKEIANFRKSLQVNQ 58

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           ++TA GI G +++ I+D ++ +EIA NV++ + ++ +
Sbjct: 59 KVITAGGIHG-IIKEINDNDVVLEIASNVKIHIDKNSI 95


>gi|46580230|ref|YP_011038.1| preprotein translocase, YajC subunit [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602385|ref|YP_966785.1| preprotein translocase, YajC subunit [Desulfovibrio vulgaris DP4]
 gi|46449647|gb|AAS96297.1| preprotein translocase, YajC subunit [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562614|gb|ABM28358.1| protein translocase subunit yajC [Desulfovibrio vulgaris DP4]
 gi|311233784|gb|ADP86638.1| preprotein translocase, YajC subunit [Desulfovibrio vulgaris RCH1]
          Length = 121

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L       ++  ++YFLLIRPQ+++ +    ML  L +G+ ++TA G+ G++V + D   
Sbjct: 25  LTSFVPLILMFAIFYFLLIRPQQKRAKEHKAMLDALGKGEHVLTAGGLYGRIVDI-DADT 83

Query: 81  LEVEIAENVRVRVVRSFVSEVQ 102
           + +++ E  +V++ R F++ V 
Sbjct: 84  VTLDLGE-TKVKIGRGFITGVV 104


>gi|213583100|ref|ZP_03364926.1| preprotein translocase subunit YajC [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 79

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 47/75 (62%)

Query: 32  VVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRV 91
           +++YF+++RPQ+++ +   +++ ++ +GD ++T  G+VG+V +V +   + + + +   V
Sbjct: 1   MIFYFMILRPQQKRTKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAEAGYIAIALNDTTEV 60

Query: 92  RVVRSFVSEVQSKSE 106
            + R FV+ V  K  
Sbjct: 61  VIKRDFVAAVLPKGT 75


>gi|260893137|ref|YP_003239234.1| preprotein translocase, YajC subunit [Ammonifex degensii KC4]
 gi|260865278|gb|ACX52384.1| preprotein translocase, YajC subunit [Ammonifex degensii KC4]
          Length = 95

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 55/86 (63%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L        +  ++YFLLIRPQ+ + ++  EML+ L+  D +VT  GI+G + ++ +D  
Sbjct: 6   LVSILWLVAIIALFYFLLIRPQQVRQRKHQEMLKALKVDDRVVTIGGIIGTIAKIKED-T 64

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + + +A+NVR+ +++  +++V S++E
Sbjct: 65  VILRVADNVRIEILKQAIAQVLSQAE 90


>gi|223040435|ref|ZP_03610709.1| preprotein translocase, YajC subunit [Campylobacter rectus RM3267]
 gi|222878285|gb|EEF13392.1| preprotein translocase, YajC subunit [Campylobacter rectus RM3267]
          Length = 96

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 55/89 (61%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            + +       VL  ++YFL+IRPQ++Q +  A M+  L +GD I+T+ G++ +V++  +
Sbjct: 4   GNFVASLLPLVVLFAIFYFLVIRPQQKQQKAHAAMIAALEKGDKIITSGGLICEVIKPEE 63

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + V++ ++V VRV R FV+    K+E
Sbjct: 64  DF-IRVKLNDDVIVRVSREFVARKIEKTE 91


>gi|292572205|gb|ADE30120.1| Preprotein translocase YajC subunit [Rickettsia prowazekii Rp22]
          Length = 133

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 58/92 (63%), Gaps = 1/92 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  V+YFLL+RPQ ++ + R +++  +++G+ ++  +GI G V 
Sbjct: 28  TNSLQSGLTSLIPMILIFAVFYFLLLRPQEKRRKEREKLVSGVKKGEEVLINSGIYGIVT 87

Query: 74  RVID-DLELEVEIAENVRVRVVRSFVSEVQSK 104
           +V + D  +E+EIA++VR++ ++S + ++ S+
Sbjct: 88  KVSENDNNIEIEIAKDVRIKAIKSAIVDITSR 119


>gi|239947203|ref|ZP_04698956.1| preprotein translocase YajC subunit [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921479|gb|EER21503.1| preprotein translocase YajC subunit [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 142

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID- 77
           S L       ++  V+YFLL+RPQ ++ + R +++  +++G+ ++T +GI G V +V + 
Sbjct: 33  SGLTSLIPMVLIFAVFYFLLLRPQEKRRKEREKLVSEVKKGEEVLTNSGIYGIVTKVSEN 92

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D  +E+EIA++VR++ ++S +  + S+++ V
Sbjct: 93  DNNIEIEIAKDVRIKALKSAIINITSRTKEV 123


>gi|149183135|ref|ZP_01861585.1| preprotein translocase subunit YajC [Bacillus sp. SG-1]
 gi|148849167|gb|EDL63367.1| preprotein translocase subunit YajC [Bacillus sp. SG-1]
          Length = 86

 Score = 87.9 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                      ++ V++YFLLIRPQ+++ +   +M   L++GD I+T  G+ G ++  I+
Sbjct: 1   MDTFATLIPLLLMFVLFYFLLIRPQQKRQKAVQQMQNELQKGDKIITIGGLHG-IIDAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           +  + V+  +  R+   R+ V EV  
Sbjct: 60  EGTIVVKCGDGSRLTYDRNAVREVIK 85


>gi|224026162|ref|ZP_03644528.1| hypothetical protein BACCOPRO_02918 [Bacteroides coprophilus DSM
          18228]
 gi|224019398|gb|EEF77396.1| hypothetical protein BACCOPRO_02918 [Bacteroides coprophilus DSM
          18228]
          Length = 102

 Score = 87.9 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 14 ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
               +      +   +  + YF +IRPQ ++ +  A   +NL  G S++TA GI GK+ 
Sbjct: 9  QAQGGADYSFLIMMVAIFAIMYFFMIRPQNKKQKEIANFRKNLEVGQSVITAGGIYGKIK 68

Query: 74 RVIDDLELEVEIAENVRVRVVRSFV 98
           + +D  + VEIA  V+++V ++ +
Sbjct: 69 EI-EDNAVIVEIASGVKIKVDKNSI 92


>gi|189485578|ref|YP_001956519.1| protein translocase subunit YajC [uncultured Termite group 1
           bacterium phylotype Rs-D17]
 gi|170287537|dbj|BAG14058.1| protein translocase subunit YajC [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 129

 Score = 87.9 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 55/106 (51%), Gaps = 5/106 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +  +AQ     ++   S         ++ V +Y  L+RPQ+++ ++  ++L +L++ D
Sbjct: 17  MPSLSFAQ----PLSEGLSSFGGLMPLILIFVFFYLFLLRPQQKKAKKHRDLLNSLKKDD 72

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            I+T  G+   V  V     +E  I++ V V++V+  +S V +K +
Sbjct: 73  RIITGGGLYATVNAVK-GNTVEARISDGVYVQIVKQLISAVITKED 117


>gi|312128458|ref|YP_003993332.1| preprotein translocase, yajc subunit [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778477|gb|ADQ07963.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 121

 Score = 87.9 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 6/113 (5%)

Query: 1   MFTTVYAQSDAPAITSATSPLE------MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLR 54
           +F   YA  +  +   A +               ++ VV Y L+I PQR++ ++  EM+ 
Sbjct: 7   LFEIAYAAGNQSSQQQAPAGATALALLAQFIPLILMFVVLYLLIIVPQRRREKQFREMIN 66

Query: 55  NLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +L  GD IVT AGI+GK+V + DD+      A+ V++++ +  V EV  K+EP
Sbjct: 67  SLIVGDEIVTNAGIIGKIVNIKDDILTIEVGADRVKLKIYKWAVKEVLKKAEP 119


>gi|284123125|ref|ZP_06386897.1| YajC [Candidatus Poribacteria sp. WGA-A3]
 gi|283829300|gb|EFC33704.1| YajC [Candidatus Poribacteria sp. WGA-A3]
          Length = 108

 Score = 87.9 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 56/86 (65%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L     F ++ VV+YFLLI PQ+++ ++  EM+  L++GD I+T+AG+ G + R+  D  
Sbjct: 23  LFSLVPFILIFVVFYFLLILPQQRKQKQHKEMITKLKKGDKIITSAGMWGAITRLDKD-T 81

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + V+I +N +V++ R  ++ +++  E
Sbjct: 82  VTVQIDDNTKVKIQRENITRLRTDEE 107


>gi|332981501|ref|YP_004462942.1| protein translocase subunit yajC [Mahella australiensis 50-1 BON]
 gi|332699179|gb|AEE96120.1| protein translocase subunit yajC [Mahella australiensis 50-1 BON]
          Length = 102

 Score = 87.5 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 50/94 (53%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
               A + +       +L VV+YF LIRPQ+++ +   +ML  L+ GD+I T  GI GK+
Sbjct: 7   PTGGAGALIASFVPLILLVVVFYFFLIRPQQKRDKETRQMLEALKVGDNITTIGGIYGKI 66

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           V + D++      ++  ++ + R  V EV++   
Sbjct: 67  VSIKDEVLTIETGSDKTKLVIARWAVKEVENPET 100


>gi|295399349|ref|ZP_06809331.1| preprotein translocase, YajC subunit [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312110091|ref|YP_003988407.1| preprotein translocase subunit YajC [Geobacillus sp. Y4.1MC1]
 gi|294978815|gb|EFG54411.1| preprotein translocase, YajC subunit [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311215192|gb|ADP73796.1| preprotein translocase, YajC subunit [Geobacillus sp. Y4.1MC1]
          Length = 92

 Score = 87.5 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           ++ ++ +        + V++YFLLIRPQ+++ +   +M  NL++GD I+T  G+ G +  
Sbjct: 2   SATSATIMNLLPIIFVFVIFYFLLIRPQQKRQRAIQQMQANLKKGDKIITIGGLHGIIDS 61

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
           V +D  + +   +  R+   RS V EV S+
Sbjct: 62  VDEDK-VVIRAGDGTRLTYDRSAVREVVSE 90


>gi|261418398|ref|YP_003252080.1| preprotein translocase subunit YajC [Geobacillus sp. Y412MC61]
 gi|319767643|ref|YP_004133144.1| preprotein translocase, YajC subunit [Geobacillus sp. Y412MC52]
 gi|261374855|gb|ACX77598.1| preprotein translocase, YajC subunit [Geobacillus sp. Y412MC61]
 gi|317112509|gb|ADU95001.1| preprotein translocase, YajC subunit [Geobacillus sp. Y412MC52]
          Length = 90

 Score = 87.5 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + +       +  V++YFLLIRPQ+++ +   +M  NL++GD I+T  G+ G +  V +D
Sbjct: 3   ATIANLLPIVLFFVIFYFLLIRPQQKRQRAIQQMQANLKKGDKIITIGGLHGIIDSVDED 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKS 105
             + V   +  R+   RS V EV ++S
Sbjct: 63  K-IIVRAGDGTRLTFDRSAVREVVAES 88


>gi|330466913|ref|YP_004404656.1| preprotein translocase subunit YajC [Verrucosispora maris
           AB-18-032]
 gi|328809884|gb|AEB44056.1| preprotein translocase, YajC subunit [Verrucosispora maris
           AB-18-032]
          Length = 95

 Score = 87.5 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  +L  V YF++IRPQ+++ +    M   L  GD +VT  G+ G V  V DD  + +E+
Sbjct: 1   MIALLFGVMYFMMIRPQQKRRREAEAMQSGLSIGDEVVTIGGLYGTVSGVEDDS-VLLEV 59

Query: 86  AENVRVRVVRSFVSEVQSKSE 106
           A  V+ R  R  ++ V +K+E
Sbjct: 60  APGVQTRYARPAIARVVTKAE 80


>gi|56963324|ref|YP_175055.1| preprotein translocase YajC subunit [Bacillus clausii KSM-K16]
 gi|56909567|dbj|BAD64094.1| preprotein translocase YajC subunit [Bacillus clausii KSM-K16]
          Length = 87

 Score = 87.5 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L     F  + V++YFLLIRPQ++Q +R  EM  NL+RGD ++T  G+ G +  + D
Sbjct: 1   MELLVSMLPFIAIIVLFYFLLIRPQQKQQKRVREMHANLQRGDKVITIGGLHGVIDSI-D 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQ 102
           +  + + + +N ++   R+ + EV 
Sbjct: 60  ESVVVLLVNDNRKLTYDRNAIREVV 84


>gi|126642936|ref|YP_001085920.1| IISP family preprotein translocase [Acinetobacter baumannii ATCC
           17978]
          Length = 84

 Score = 87.5 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  V   ++YFL+ RPQ ++ +    ++ +L  G  +V A G++GKV ++  D  + VE+
Sbjct: 1   MIVVFVAIFYFLIWRPQAKRAKEHRSLIESLGVGSEVVFAGGLMGKVTKLEGDYAV-VEL 59

Query: 86  AENVRVRVVRSFVSEVQSKSE 106
              V V++ R+ V  V  +  
Sbjct: 60  NRGVEVKIQRASVISVLPEGT 80


>gi|309807399|ref|ZP_07701362.1| preprotein translocase, YajC subunit [Lactobacillus iners LactinV
           01V1-a]
 gi|309809630|ref|ZP_07703486.1| preprotein translocase, YajC subunit [Lactobacillus iners SPIN
           2503V10-D]
 gi|312873735|ref|ZP_07733780.1| preprotein translocase, YajC subunit [Lactobacillus iners LEAF
           2052A-d]
 gi|325911925|ref|ZP_08174328.1| preprotein translocase, YajC subunit [Lactobacillus iners UPII
           143-D]
 gi|308169321|gb|EFO71376.1| preprotein translocase, YajC subunit [Lactobacillus iners LactinV
           01V1-a]
 gi|308169990|gb|EFO72027.1| preprotein translocase, YajC subunit [Lactobacillus iners SPIN
           2503V10-D]
 gi|311090733|gb|EFQ49132.1| preprotein translocase, YajC subunit [Lactobacillus iners LEAF
           2052A-d]
 gi|325476227|gb|EGC79390.1| preprotein translocase, YajC subunit [Lactobacillus iners UPII
           143-D]
          Length = 118

 Score = 87.5 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 48/93 (51%), Gaps = 1/93 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  S+ S L    +  ++    YF +IRPQ++Q Q R +ML  L++GD ++   G+  K+
Sbjct: 7   AANSSNSMLVTIFMVVIMFGFMYFAMIRPQKKQQQVRMKMLSELKKGDKVILLDGMHCKI 66

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
             +  D  + V+ A+ + +   RS + ++    
Sbjct: 67  DTINGDDTIVVD-ADGIFLTFSRSAIRQILPDD 98


>gi|116331686|ref|YP_801404.1| preprotein translocase, YajC subunit [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116125375|gb|ABJ76646.1| Preprotein translocase, YajC subunit [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 109

 Score = 87.5 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 36/98 (36%), Positives = 55/98 (56%), Gaps = 4/98 (4%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
              A     SP     L  ++ V+ YFL+IRPQR + ++R EM+  L++GD +VT++GI 
Sbjct: 12  AQAAGAGDKSPFSTLLLIPIMLVIMYFLVIRPQRNEEKKRKEMIGGLKKGDEVVTSSGIH 71

Query: 70  GKVVRVIDDLELEVE-IAENVRVRVVRSFVSEVQSKSE 106
           GKVV + D+ E+ V  IA++  V       S V  K +
Sbjct: 72  GKVVEIKDNNEVVVLNIAKDTNVSF---AASTVLKKKQ 106


>gi|238063872|ref|ZP_04608581.1| preprotein translocase subunit yajC [Micromonospora sp. ATCC 39149]
 gi|237885683|gb|EEP74511.1| preprotein translocase subunit yajC [Micromonospora sp. ATCC 39149]
          Length = 96

 Score = 87.5 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  +L  V YF++IRPQ+++ +    M   L  GD +VT  G+ G V  V DD  + +E+
Sbjct: 1   MIALLFGVMYFMMIRPQQKRRREAERMQSALAPGDEVVTIGGLYGTVTGV-DDETVLIEV 59

Query: 86  AENVRVRVVRSFVSEVQS 103
           A  V+ R  R  ++ V S
Sbjct: 60  APGVQTRYARPAIARVVS 77


>gi|302190967|ref|ZP_07267221.1| preprotein translocase subunit YajC [Lactobacillus iners AB-1]
 gi|309805308|ref|ZP_07699359.1| preprotein translocase, YajC subunit [Lactobacillus iners LactinV
           09V1-c]
 gi|309805999|ref|ZP_07700025.1| preprotein translocase, YajC subunit [Lactobacillus iners LactinV
           03V1-b]
 gi|312870738|ref|ZP_07730845.1| preprotein translocase, YajC subunit [Lactobacillus iners LEAF
           3008A-a]
 gi|312872856|ref|ZP_07732918.1| preprotein translocase, YajC subunit [Lactobacillus iners LEAF
           2062A-h1]
 gi|312875186|ref|ZP_07735199.1| preprotein translocase, YajC subunit [Lactobacillus iners LEAF
           2053A-b]
 gi|315653060|ref|ZP_07905988.1| preprotein translocase [Lactobacillus iners ATCC 55195]
 gi|325913748|ref|ZP_08176109.1| preprotein translocase, YajC subunit [Lactobacillus iners UPII
           60-B]
 gi|329919603|ref|ZP_08276592.1| preprotein translocase, YajC subunit [Lactobacillus iners SPIN
           1401G]
 gi|308165384|gb|EFO67616.1| preprotein translocase, YajC subunit [Lactobacillus iners LactinV
           09V1-c]
 gi|308167602|gb|EFO69755.1| preprotein translocase, YajC subunit [Lactobacillus iners LactinV
           03V1-b]
 gi|311089293|gb|EFQ47724.1| preprotein translocase, YajC subunit [Lactobacillus iners LEAF
           2053A-b]
 gi|311091590|gb|EFQ49972.1| preprotein translocase, YajC subunit [Lactobacillus iners LEAF
           2062A-h1]
 gi|311093750|gb|EFQ52087.1| preprotein translocase, YajC subunit [Lactobacillus iners LEAF
           3008A-a]
 gi|315489595|gb|EFU79229.1| preprotein translocase [Lactobacillus iners ATCC 55195]
 gi|325476948|gb|EGC80099.1| preprotein translocase, YajC subunit [Lactobacillus iners UPII
           60-B]
 gi|328937408|gb|EGG33830.1| preprotein translocase, YajC subunit [Lactobacillus iners SPIN
           1401G]
          Length = 118

 Score = 87.1 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 48/93 (51%), Gaps = 1/93 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  S+ S L    +  ++    YF +IRPQ++Q Q R +ML  L++GD ++   G+  K+
Sbjct: 7   AANSSNSMLVTIFMVVIMFGFMYFAMIRPQKKQQQVRMKMLSELKKGDKVILLDGMHCKI 66

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
             +  D  + V+ A+ + +   RS + ++    
Sbjct: 67  DTINGDDTIVVD-ADGIFLTFSRSAIRQILPDD 98


>gi|332829207|gb|EGK01871.1| hypothetical protein HMPREF9455_02019 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 116

 Score = 87.1 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M  +  +L  + YF +IRPQ+++ +   E    ++ GD +VTA GI GKV  V +D    
Sbjct: 30  MIVMMVLLFAIMYFFMIRPQQKKQKALQEARNAIKVGDKVVTAGGIHGKVKEV-NDSTFV 88

Query: 83  VEIAENVRVRVVRSFV 98
           +EIA+ +++ + +S V
Sbjct: 89  LEIADGIKITIEKSSV 104


>gi|292492394|ref|YP_003527833.1| preprotein translocase subunit YajC [Nitrosococcus halophilus Nc4]
 gi|291580989|gb|ADE15446.1| preprotein translocase, YajC subunit [Nitrosococcus halophilus Nc4]
          Length = 114

 Score = 87.1 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++ +AQ  A A   A   L       VL V++YFLLIRPQ+++ +   +++  L++GD 
Sbjct: 9   ISSAWAQEPAAAPPQAG--LFNIIFLLVLLVLFYFLLIRPQQKRAKEHNKLVEGLQKGDE 66

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++T  GI+G++  + +   + +E++ENV +++ R  V+ V  K  
Sbjct: 67  VMTEGGIMGRITELAE-SVVALEVSENVEIKIRRQSVASVLPKGT 110


>gi|116328775|ref|YP_798495.1| preprotein translocase, YajC subunit [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116121519|gb|ABJ79562.1| Preprotein translocase, YajC subunit [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
          Length = 109

 Score = 87.1 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 36/98 (36%), Positives = 55/98 (56%), Gaps = 4/98 (4%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
              A     SP     L  ++ V+ YFL+IRPQR + ++R EM+  L++GD +VT++GI 
Sbjct: 12  AQAAGEGDKSPFSTLLLIPIMLVIMYFLVIRPQRNEEKKRKEMIGGLKKGDEVVTSSGIH 71

Query: 70  GKVVRVIDDLELEVE-IAENVRVRVVRSFVSEVQSKSE 106
           GKVV + D+ E+ V  IA++  V       S V  K +
Sbjct: 72  GKVVEIKDNNEVVVLNIAKDTNVSF---AASTVLKKKQ 106


>gi|297626358|ref|YP_003688121.1| Preprotein translocase subunit YajC [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296922123|emb|CBL56691.1| Preprotein translocase subunit YajC [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
          Length = 167

 Score = 87.1 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           +   F  L  ++YF+ IRPQR+Q +++ EM   +  G  ++  +GI G V  + D   + 
Sbjct: 6   LIIAFVALIALFYFMTIRPQRKQAEKQREMHNAIEPGTRVMLTSGIYGTVTAIGDKQFV- 64

Query: 83  VEIAENVRVRVVRSFVSEVQ 102
           +E+A  V + V++  +  V 
Sbjct: 65  LELAPGVDITVLKQAIVRVV 84


>gi|225019141|ref|ZP_03708333.1| hypothetical protein CLOSTMETH_03093 [Clostridium methylpentosum
           DSM 5476]
 gi|224948088|gb|EEG29297.1| hypothetical protein CLOSTMETH_03093 [Clostridium methylpentosum
           DSM 5476]
          Length = 106

 Score = 87.1 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 47/92 (51%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
             A       S      +  V+ ++ Y L+IRPQ+++ +    M  N++ GD +VTA GI
Sbjct: 8   QAAGQSGGMLSMAMPFIMLAVMFLIMYLLIIRPQKKRDKETQAMRNNIQVGDEVVTAGGI 67

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           VG+VV + +D  +    ++  ++R+ R  V  
Sbjct: 68  VGRVVNIKEDTIVLETGSDRSKIRIKRWAVQS 99


>gi|325270435|ref|ZP_08137039.1| preprotein translocase [Prevotella multiformis DSM 16608]
 gi|324987231|gb|EGC19210.1| preprotein translocase [Prevotella multiformis DSM 16608]
          Length = 109

 Score = 87.1 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 11 APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
          A    S  SP+ M  +   +  + +F +IRPQ+++ +        L  GDS+VT  GI G
Sbjct: 8  AAQAASQGSPMPMIIMMVAIFAIMWFFMIRPQQKKQKAIRAFQNALSAGDSVVTGGGIYG 67

Query: 71 KVVRVI-DDLELEVEIAENVRVRVVRSFV 98
           V  +     +++VEIA  V + V +S+V
Sbjct: 68 TVKHIDLTTGKVDVEIARGVVITVDKSYV 96


>gi|229497094|ref|ZP_04390798.1| preprotein translocase, YajC subunit [Porphyromonas endodontalis
          ATCC 35406]
 gi|229316019|gb|EEN81948.1| preprotein translocase, YajC subunit [Porphyromonas endodontalis
          ATCC 35406]
          Length = 110

 Score = 87.1 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          +F    A  +A              +  VL ++++   IRPQ ++ +        +  GD
Sbjct: 3  LFLLQAAAPEAAKGGLMGGSWGTIIMMVVLILIFWLFFIRPQSKRQKELQRKREAMTEGD 62

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           ++TA GI GK+ +V+D   + +EIA++V++RV +S V
Sbjct: 63 KVITAGGIHGKISKVLDKEFV-IEIAKDVQIRVDKSSV 99


>gi|268680242|ref|YP_003304673.1| preprotein translocase, YajC subunit [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268618273|gb|ACZ12638.1| preprotein translocase, YajC subunit [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 91

 Score = 87.1 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 51/86 (59%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
             + + +       VL  ++YFL+IRPQ++Q+++  EM+  L++GD ++T  G++ +VV+
Sbjct: 2   QGSANLISSLLPLVVLFAIFYFLVIRPQQKQVKKHKEMIDALKKGDKVITNGGLICEVVK 61

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSE 100
             +D        E V V+V R ++S+
Sbjct: 62  PEEDSIKVKLNDEGVIVKVSRDYISK 87


>gi|317128207|ref|YP_004094489.1| preprotein translocase, YajC subunit [Bacillus cellulosilyticus DSM
           2522]
 gi|315473155|gb|ADU29758.1| preprotein translocase, YajC subunit [Bacillus cellulosilyticus DSM
           2522]
          Length = 86

 Score = 87.1 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 48/88 (54%), Gaps = 2/88 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +       ++  ++YFLLIRPQ+++ ++  EM   L++GD I+T  G+ GK+  + +
Sbjct: 1   MEFMTALLPLLLMFAIFYFLLIRPQQKRQRKIQEMHGALQKGDKIITIGGLHGKIDAIDE 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKS 105
           D  + +++    ++   R  V +V +K 
Sbjct: 61  D-RIVLDVGS-SKLTFDRQAVRDVINKD 86


>gi|218960356|ref|YP_001740131.1| Preprotein translocase subunit YajC [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729013|emb|CAO79924.1| Preprotein translocase subunit YajC [Candidatus Cloacamonas
           acidaminovorans]
          Length = 113

 Score = 86.7 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
             +  Q+     T             ++ V+ Y LLIRPQ+++ +   +M  +L+  D +
Sbjct: 2   NYILLQAAQKGTTQQGGAGTTLIFMIIMFVILYLLLIRPQQKKAKETQKMQDSLKVNDKV 61

Query: 63  VTAAGIVGKVVRVIDDL-ELEVEIAENVRVR--VVRSFVSEVQSKSEP 107
           +T++GI G+VV +  D   + +EI +  +VR  + ++ +  V + SEP
Sbjct: 62  ITSSGIYGRVVSIKPDKGIVVLEIDDTNKVRIDIQKNAIIGVVTTSEP 109


>gi|260655922|ref|ZP_05861391.1| preprotein translocase, YajC subunit [Jonquetella anthropi E3_33
           E1]
 gi|260629538|gb|EEX47732.1| preprotein translocase, YajC subunit [Jonquetella anthropi E3_33
           E1]
          Length = 127

 Score = 86.7 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
              +  V+  ++YFLLIRPQ+++ ++  EML++++RGD ++TA G  G V    DD  L 
Sbjct: 16  SVIMIVVMIAIFYFLLIRPQKKRQKKHDEMLQSIKRGDVVITAGGFWGTVRDFKDDS-LI 74

Query: 83  VEIAENVRVRVVRSFVSE 100
           +EIA  V+ +V++S +S 
Sbjct: 75  IEIASGVKAKVMKSSISA 92


>gi|271967388|ref|YP_003341584.1| preprotein translocase subunit YajC [Streptosporangium roseum DSM
           43021]
 gi|270510563|gb|ACZ88841.1| preprotein translocase subunit YajC, putative [Streptosporangium
           roseum DSM 43021]
          Length = 121

 Score = 86.7 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                   +  ++ VV+YFLLIRPQR++ Q +A+M  +L  G  I+T  G+   VV +  
Sbjct: 1   MGDYSSLIMIALMVVVFYFLLIRPQRKRQQEQAQMQNSLTSGTRIMTTTGLFATVVAIDA 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           D  + +EIA  V  R V++ +  V     PV
Sbjct: 61  DD-VILEIAPGVETRWVKAAIGRVL---TPV 87


>gi|308174471|ref|YP_003921176.1| hypothetical protein BAMF_2580 [Bacillus amyloliquefaciens DSM 7]
 gi|307607335|emb|CBI43706.1| conserved hypothetical protein [Bacillus amyloliquefaciens DSM 7]
 gi|328554391|gb|AEB24883.1| preprotein translocase subunit YajC [Bacillus amyloliquefaciens
           TA208]
 gi|328912796|gb|AEB64392.1| hypothetical protein LL3_02860 [Bacillus amyloliquefaciens LL3]
          Length = 86

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++  V YFLLIRPQ++Q +   +M   L++GDS+VT  G+ G V  + D
Sbjct: 1   MGTLGTIVPIILMFAVLYFLLIRPQQKQQKAVRQMQEELKKGDSVVTIGGLHGTVDSI-D 59

Query: 78  DLELEVEIAENVRVRVVRSFVSE 100
           + ++ ++  +N R+   R  + E
Sbjct: 60  ESKVVIKTGDNTRLTFDRRAIRE 82


>gi|288555347|ref|YP_003427282.1| preprotein Sec translocase subunit YajC [Bacillus pseudofirmus OF4]
 gi|288546507|gb|ADC50390.1| Preprotein Sec translocase subunit YajC [Bacillus pseudofirmus OF4]
          Length = 87

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       ++  ++YFLLIRPQ+++ +   +M  NL+RGD I+T  G+ G +  + +D+ 
Sbjct: 4   IGTLLPLILMFAIFYFLLIRPQQKRQKSIRDMHANLQRGDKIITIGGMHGVIDAIDEDVI 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           + + + EN ++   R+ V EV +
Sbjct: 64  IIL-VNENRKLTFDRAAVREVVN 85


>gi|237740333|ref|ZP_04570814.1| translocase subunit YajC [Fusobacterium sp. 2_1_31]
 gi|229422350|gb|EEO37397.1| translocase subunit YajC [Fusobacterium sp. 2_1_31]
          Length = 82

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  +   V+YFLLIRP +++ + +  +L +L+ G  ++T  GI G +  V +D  +E+ +
Sbjct: 1   MVVLWIGVFYFLLIRPNKKRQKEQQNLLNSLKEGTEVITIGGIKGTIAFVGED-YVELRV 59

Query: 86  AENVRVRVVRSFVSEVQS 103
            + V++   +S ++ V S
Sbjct: 60  DKGVKLTFRKSAIANVIS 77


>gi|225848694|ref|YP_002728857.1| preprotein translocase subunit YajC [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643119|gb|ACN98169.1| preprotein translocase, YajC subunit [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 99

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 54/94 (57%), Gaps = 1/94 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                   +       +L  ++YFLL RPQ+QQ ++  E L+NL++G+ ++T  GI+G+V
Sbjct: 2   QGDPMGGLISAIVWMVLLIGIFYFLLYRPQQQQRKKHEEFLKNLKKGEKVITTGGIIGEV 61

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + ID+  + +++ E   ++V++  V+   ++ E
Sbjct: 62  -KQIDEKTITLKVCETCSIKVLKPSVAAYYTEEE 94


>gi|195953181|ref|YP_002121471.1| preprotein translocase, YajC subunit [Hydrogenobaculum sp. Y04AAS1]
 gi|195932793|gb|ACG57493.1| preprotein translocase, YajC subunit [Hydrogenobaculum sp. Y04AAS1]
          Length = 103

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
                  L       ++ V++YFL+I+PQ+ Q ++  E L NL++GD ++T++GI G + 
Sbjct: 3   GNPMGPILAQLVFIGIIFVIFYFLIIKPQQTQRKKHQEFLSNLKKGDKVITSSGIWGVIS 62

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            + DD  + +++  N +++  +  +   Q 
Sbjct: 63  DITDD-TITLKVDTNTKIKFTKETIIAYQP 91


>gi|293379291|ref|ZP_06625437.1| preprotein translocase, YajC subunit [Enterococcus faecium PC4.1]
 gi|292642087|gb|EFF60251.1| preprotein translocase, YajC subunit [Enterococcus faecium PC4.1]
          Length = 126

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +
Sbjct: 1   MGSLPMLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDN 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           D    V   E + +   R+ +  V+ 
Sbjct: 60  DKRTVVLDCEGIFLEYDRAAIKTVKP 85


>gi|281420712|ref|ZP_06251711.1| preprotein translocase, YajC subunit [Prevotella copri DSM 18205]
 gi|281405485|gb|EFB36165.1| preprotein translocase, YajC subunit [Prevotella copri DSM 18205]
          Length = 104

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
              +  S +    +   +  + +F +IRPQ+++ +   +    L  G  +VT  G+ G V
Sbjct: 7   QAAAGGSSMSFLIMMVAIFAIMWFFMIRPQQKKQKEIRKFQNALAEGTKVVTGGGVYGTV 66

Query: 73  VRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            RV  +   ++VEIA  V + V + +V    +   P
Sbjct: 67  KRVDLEANTVDVEIARGVVITVAKGYVFADAASQTP 102


>gi|261884578|ref|ZP_06008617.1| preprotein translocase subunit YajC [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 93

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       VL  + YFL+I PQ++Q +     L NL++GD IVT  G++ +VV+  +D  
Sbjct: 5   VSSLLPRIVLFAILYFLVISPQQKQQKEHRNTLSNLQKGDKIVTNGGLLCEVVK-PEDDF 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++V++ + V VR+ R+FV++   K E
Sbjct: 64  IKVKLNDEVIVRIDRNFVAKKIDKIE 89


>gi|157803568|ref|YP_001492117.1| preprotein translocase subunit YajC [Rickettsia canadensis str.
           McKiel]
 gi|157784831|gb|ABV73332.1| preprotein translocase subunit YajC [Rickettsia canadensis str.
           McKiel]
          Length = 145

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 60/98 (61%), Gaps = 3/98 (3%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S  S L       ++  ++YFLL+RPQ ++ + R ++   +++G+ ++T +GI G V 
Sbjct: 28  TNSLQSGLTSLIPMILIFAIFYFLLLRPQEKRRKEREKLANKVKKGEEVLTNSGIYGIVS 87

Query: 74  RVI-DDLELEVEIAENVRVRVVRSFVSEVQ--SKSEPV 108
           +V  +D  +E+EIA++V +++++S + ++   SK  PV
Sbjct: 88  KVSANDPNIEIEIAKDVHIKILKSTIIDITSHSKEVPV 125


>gi|167753512|ref|ZP_02425639.1| hypothetical protein ALIPUT_01787 [Alistipes putredinis DSM 17216]
 gi|167658137|gb|EDS02267.1| hypothetical protein ALIPUT_01787 [Alistipes putredinis DSM 17216]
          Length = 107

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 4/100 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M   + A + AP          +  +  ++ +V YF + RP+ ++ ++ A+    L++GD
Sbjct: 1   MINLLQATAPAPQAGGG---YSLFIMLGLMILVLYFFMWRPESKRRKQMAQFRAGLKKGD 57

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
            I+TA GI G V  + +   L +E+  NV +R+ ++ V  
Sbjct: 58  KIITAGGIYGVVKEIKE-TTLLIEVDGNVTLRIDKNMVVA 96


>gi|52081248|ref|YP_080039.1| preprotein translocase subunit YajC [Bacillus licheniformis ATCC
           14580]
 gi|52786628|ref|YP_092457.1| preprotein translocase subunit YajC [Bacillus licheniformis ATCC
           14580]
 gi|319644785|ref|ZP_07999018.1| hypothetical protein HMPREF1012_00051 [Bacillus sp. BT1B_CT2]
 gi|52004459|gb|AAU24401.1| preprotein translocase subunit YrbF [Bacillus licheniformis ATCC
           14580]
 gi|52349130|gb|AAU41764.1| YrbF [Bacillus licheniformis ATCC 14580]
 gi|317392594|gb|EFV73388.1| hypothetical protein HMPREF1012_00051 [Bacillus sp. BT1B_CT2]
          Length = 86

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++  V YFLLIRPQ++Q +   +M   L++GD +VT  G+ G +V  ID
Sbjct: 1   MEMLGTLLPIILMFAVLYFLLIRPQQKQQKAVRQMQEELKKGDKVVTIGGLHG-IVDSID 59

Query: 78  DLELEVEIAENVRVRVVRSFVSE 100
           + ++ ++  +N R+   R  + E
Sbjct: 60  ESKVVIKTGDNTRLTFDRRAIRE 82


>gi|302391492|ref|YP_003827312.1| preprotein translocase, YajC subunit [Acetohalobium arabaticum DSM
           5501]
 gi|302203569|gb|ADL12247.1| preprotein translocase, YajC subunit [Acetohalobium arabaticum DSM
           5501]
          Length = 94

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            + +     +  +  +++FL IRPQ+++ Q   +M+ NL  GD I+T  GI GK+ ++ D
Sbjct: 1   MNIVMSILPWVAIFGIFWFLFIRPQKKKQQEHEDMVDNLEVGDEIITIGGIKGKITKI-D 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEV 101
             E  ++I+  V V V+R+ V  +
Sbjct: 60  GDEFRLKISPEVEVEVIRNAVGRL 83


>gi|20807640|ref|NP_622811.1| preprotein translocase subunit YajC [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516183|gb|AAM24415.1| Preprotein translocase subunit YajC [Thermoanaerobacter
           tengcongensis MB4]
          Length = 101

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 52/83 (62%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
              F +L  ++YFLLI PQ+++ ++  EML +LR GD I+T +G  GK++ + DD+    
Sbjct: 8   LIQFAILIAIFYFLLILPQQRRQKKEREMLDSLRPGDEIITKSGFYGKILNIKDDVITLE 67

Query: 84  EIAENVRVRVVRSFVSEVQSKSE 106
             A+ VR+++ +  V  V S++E
Sbjct: 68  MGADKVRLKIAKWAVGGVVSRAE 90


>gi|222528416|ref|YP_002572298.1| preprotein translocase, YajC subunit [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222455263|gb|ACM59525.1| preprotein translocase, YajC subunit [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 121

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 6/113 (5%)

Query: 1   MFTTVYAQSDAPAITSATSPLE------MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLR 54
           +F   YA  +  +   A +               ++ VV Y L+I PQR++ ++  EM+ 
Sbjct: 7   LFEIAYATGNQNSQQQAPAGATALALLAQFIPLILMFVVLYLLIIVPQRRREKQFREMIN 66

Query: 55  NLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +L  GD IVT AGI+GK+V + DD+      A+ V++++ +  V EV  K+EP
Sbjct: 67  SLIVGDEIVTNAGIIGKIVNIKDDILTIEVGADRVKLKIYKWAVKEVLKKAEP 119


>gi|86158963|ref|YP_465748.1| protein translocase subunit yajC [Anaeromyxobacter dehalogenans
          2CP-C]
 gi|85775474|gb|ABC82311.1| protein translocase subunit yajC [Anaeromyxobacter dehalogenans
          2CP-C]
          Length = 115

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 55/99 (55%), Gaps = 1/99 (1%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M   ++A     A   A +P+     F  +AVV+YF+  RPQ +Q +     +  L++GD
Sbjct: 1  MHPVLHAFLSQTADGQAQNPIVTFLPFIAIAVVFYFVFFRPQAKQAKAHQAFVTALKKGD 60

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVS 99
           +VT +GI+G VV V +D  + +++    ++RV++  V+
Sbjct: 61 EVVTQSGIIGTVVLV-EDRTVTIDVGAGTKLRVLKGQVA 98


>gi|197121718|ref|YP_002133669.1| preprotein translocase, YajC subunit [Anaeromyxobacter sp. K]
 gi|196171567|gb|ACG72540.1| preprotein translocase, YajC subunit [Anaeromyxobacter sp. K]
          Length = 115

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 55/99 (55%), Gaps = 1/99 (1%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M   ++A     A   A +P+     F  +AVV+YF+  RPQ +Q +     +  L++GD
Sbjct: 1  MHPVLHAFLSQTADGQAQNPIVAFLPFIAIAVVFYFVFFRPQAKQAKAHQSFVAALKKGD 60

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVS 99
           +VT +GI+G VV V +D  + +++    ++RV++  V+
Sbjct: 61 EVVTQSGIIGTVVLV-EDRTVTIDVGAGTKLRVLKGQVA 98


>gi|311069255|ref|YP_003974178.1| preprotein translocase subunit YajC [Bacillus atrophaeus 1942]
 gi|310869772|gb|ADP33247.1| preprotein translocase subunit YajC [Bacillus atrophaeus 1942]
          Length = 87

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            T  L       ++  V YFLLIRPQ++Q +    M   L++GD++VT  G+ G V  + 
Sbjct: 1   MTGTLGTLVPIILMFAVLYFLLIRPQQKQQKAVKRMQEELKKGDAVVTIGGLHGTVDSI- 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSE 100
           D+ ++ ++  EN R+   R  + E
Sbjct: 60  DESKVVIKTGENTRLTFDRRAIRE 83


>gi|294782573|ref|ZP_06747899.1| preprotein translocase, YajC subunit [Fusobacterium sp. 1_1_41FAA]
 gi|294481214|gb|EFG28989.1| preprotein translocase, YajC subunit [Fusobacterium sp. 1_1_41FAA]
          Length = 94

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
               +   V+YFLLIRP +++ + +  +L +L+ G  ++T  GI G +  V +D  +E+ 
Sbjct: 13  IFIVLWIGVFYFLLIRPNKKRQKEQQNLLNSLKEGTEVITIGGIKGTIAFVGED-YVELR 71

Query: 85  IAENVRVRVVRSFVSEVQS 103
           + + V++   +S ++ V +
Sbjct: 72  VDKGVKLTFRKSAIANVIN 90


>gi|327405410|ref|YP_004346248.1| protein translocase subunit yajC [Fluviicola taffensis DSM 16823]
 gi|327320918|gb|AEA45410.1| protein translocase subunit yajC [Fluviicola taffensis DSM 16823]
          Length = 87

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
               +   + VV+YF LIRPQ+++ +       NL++GD +VT  GI GK++ + D    
Sbjct: 1   MQILMLVAMLVVFYFFLIRPQQKKQKELKSFRENLKQGDKVVTIGGIHGKILEITD--TT 58

Query: 82  EVEIAENVRVRVVRSFVSEVQSKS 105
            +  AE  ++R  +S +S   +++
Sbjct: 59  ILISAEGTKLRFEKSAISTAVAET 82


>gi|167770635|ref|ZP_02442688.1| hypothetical protein ANACOL_01981 [Anaerotruncus colihominis DSM
           17241]
 gi|167667230|gb|EDS11360.1| hypothetical protein ANACOL_01981 [Anaerotruncus colihominis DSM
           17241]
          Length = 100

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 47/85 (55%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
             T+ +       ++ V++YF+LIRPQ+++ +  A M  NL  GD IVT  GI+G VV +
Sbjct: 4   QTTATMMSLLPLILIFVIFYFMLIRPQKKRDKETARMRANLEVGDEIVTVGGIIGTVVVI 63

Query: 76  IDDLELEVEIAENVRVRVVRSFVSE 100
            DD  +    ++  +VR+ R  V  
Sbjct: 64  KDDHLIIETGSDRSKVRITRWAVQA 88


>gi|301166845|emb|CBW26422.1| putative preprotein translocase YajC subunit [Bacteriovorax marinus
           SJ]
          Length = 115

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + T V AQ    A     + L        +  ++YFL+IRPQ ++ +    ML  L +G+
Sbjct: 5   LMTPVMAQEA-AAAAGQPNALSSFLPMIAVFAIFYFLMIRPQAKKAKEEQAMLSQLGKGE 63

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
            I T +G+ G +  +  D  + +EIAE  +V+V+RS +
Sbjct: 64  EIFTKSGLFGTITGIT-DKVITLEIAEGTKVKVLRSHI 100


>gi|78356860|ref|YP_388309.1| protein translocase subunit yajC [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219265|gb|ABB38614.1| protein translocase subunit yajC [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 119

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 56/94 (59%), Gaps = 7/94 (7%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           +P+       ++  ++YF+LIRPQ+++ +   EML NL++GD ++T  G+ G +V V D+
Sbjct: 22  NPIMSFVPLILMFAIFYFMLIRPQQKKAKEHREMLGNLKKGDRVITGGGLYGCIVEVSDE 81

Query: 79  LELEVEIAENVRVRVVRSFVSEVQ-----SKSEP 107
             L V++ + V V+V R F+S +       K EP
Sbjct: 82  -WLSVDLGQTV-VKVGRGFISGLADPKNGKKEEP 113


>gi|317132375|ref|YP_004091689.1| preprotein translocase, YajC subunit [Ethanoligenens harbinense
           YUAN-3]
 gi|315470354|gb|ADU26958.1| preprotein translocase, YajC subunit [Ethanoligenens harbinense
           YUAN-3]
          Length = 105

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 49/93 (52%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           +   +   A S + +  +  ++ VV YF +IRPQR++ +    M  NL  GD I T  GI
Sbjct: 5   AATSSTGDAFSSISIFVVIILMFVVMYFFMIRPQRKKEKEAKAMRENLVVGDEITTIGGI 64

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           VG+VV + DD  +    A+  ++R+ +  +  V
Sbjct: 65  VGRVVSIKDDTIVIETGADREKIRIRKWAIQSV 97


>gi|320352168|ref|YP_004193507.1| protein translocase subunit YajC [Desulfobulbus propionicus DSM
          2032]
 gi|320120670|gb|ADW16216.1| protein translocase subunit yajC [Desulfobulbus propionicus DSM
          2032]
          Length = 113

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 15 TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +  + +       ++ +V+YFLLIRPQ+++ +     L NL++GD ++T  GI G++V 
Sbjct: 14 PTGLASVAQFVPLILIFIVFYFLLIRPQQKKAKEHQNYLANLKKGDKVITGGGIHGQIVG 73

Query: 75 VIDDLELEVEIAENVRVRVVR 95
          +  D    +EIAENVR++V R
Sbjct: 74 LT-DTVATLEIAENVRIKVNR 93


>gi|291519262|emb|CBK74483.1| protein translocase subunit yajC [Butyrivibrio fibrisolvens 16/4]
          Length = 101

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 53/92 (57%), Gaps = 2/92 (2%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S + +     VL V  YF +IRPQ+++ + +  M+ +L  GD+++T +G  G ++ + DD
Sbjct: 3   SSISLIIWVVVLFVFMYFFMIRPQQKEQKEKTAMMSSLAIGDTVLTTSGFYGVIIAIPDD 62

Query: 79  LELEVE--IAENVRVRVVRSFVSEVQSKSEPV 108
             + VE    +N R+ + ++ +++V+   + V
Sbjct: 63  STVIVEFGSNKNCRIPMTKNAIAQVEKPEDAV 94


>gi|157693173|ref|YP_001487635.1| preprotein translocase subunit YajC [Bacillus pumilus SAFR-032]
 gi|194017299|ref|ZP_03055911.1| preprotein translocase, YajC subunit [Bacillus pumilus ATCC 7061]
 gi|157681931|gb|ABV63075.1| preprotein translocase subunit YajC [Bacillus pumilus SAFR-032]
 gi|194011167|gb|EDW20737.1| preprotein translocase, YajC subunit [Bacillus pumilus ATCC 7061]
          Length = 88

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
               +    +  V+  V YFLLIRPQ++Q +   +M ++L +GD IVT  G+ G++   I
Sbjct: 1   MDGGMGSIIMIVVMFAVLYFLLIRPQQKQQKAVRQMQQSLSKGDKIVTIGGLHGEI-DYI 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           D+ ++ ++ +EN R+   R  + E+  K 
Sbjct: 60  DESKVVIKTSENNRLTFDRRAIRELADKG 88


>gi|323697903|ref|ZP_08109815.1| preprotein translocase, YajC subunit [Desulfovibrio sp. ND132]
 gi|323457835|gb|EGB13700.1| preprotein translocase, YajC subunit [Desulfovibrio desulfuricans
           ND132]
          Length = 120

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  ++  ++YFLLIRPQ+++ +    ML  L++GD + T  GI+G +V +  D  L +EI
Sbjct: 34  MLVLMFAIFYFLLIRPQQKKQKAHRAMLDALKKGDKVWTNGGILGAIVDIDGDN-LTIEI 92

Query: 86  AENVRVRVVRSFVSE 100
           A  V V + R FV++
Sbjct: 93  ASGVNVVIKRGFVAD 107


>gi|315452892|ref|YP_004073162.1| protein export-membrane protein, YajC [Helicobacter felis ATCC
           49179]
 gi|315131944|emb|CBY82572.1| protein export-membrane protein, YajC [Helicobacter felis ATCC
           49179]
          Length = 104

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L       VL  ++YFL+IRPQR Q ++  EML NL++GD IV+  G++ +V++  +   
Sbjct: 8   LTSILPLLVLFAIFYFLIIRPQRVQAKKHKEMLDNLQKGDKIVSQGGLICEVIK-PEANF 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
            +V + E + V++ +++V+    +  P
Sbjct: 67  FKVRLNEGLEVKLAKNYVAYKLDEESP 93


>gi|220932065|ref|YP_002508973.1| preprotein translocase, YajC subunit [Halothermothrix orenii H 168]
 gi|219993375|gb|ACL69978.1| preprotein translocase, YajC subunit [Halothermothrix orenii H 168]
          Length = 91

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                +L  V++  LIRPQ++Q +   EML NL  GD +VT  GI GKV+++ DD  + +
Sbjct: 8   VLPLVILFGVFWLFLIRPQKKQQKEHQEMLANLETGDKVVTIGGIKGKVIKIKDD-IIRL 66

Query: 84  EIAENVRVRVVRSFVSEV 101
            ++ NV +  V++ ++ +
Sbjct: 67  RVSSNVDIDFVKNAIARL 84


>gi|315645790|ref|ZP_07898911.1| preprotein translocase, YajC subunit [Paenibacillus vortex V453]
 gi|315278551|gb|EFU41865.1| preprotein translocase, YajC subunit [Paenibacillus vortex V453]
          Length = 116

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
            F ++ V++YFLLIRPQ+++ + R  ML  L +GD +VT  G+ G +V + DD  + +++
Sbjct: 37  PFVLMFVIFYFLLIRPQQKKQKTRNAMLSALSKGDKVVTIGGLHGTIVEITDD-IVVLKV 95

Query: 86  AENVRVRVVRSFVSE 100
            +  ++   R+ +S 
Sbjct: 96  NDVTKLTFDRNSISH 110


>gi|237755763|ref|ZP_04584367.1| preprotein translocase, YajC subunit [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692073|gb|EEP61077.1| preprotein translocase, YajC subunit [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 101

 Score = 85.9 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                   +       +   ++YFL++RPQ+QQ ++  E L+NL++G+ ++T  GI+G++
Sbjct: 2   QGDPMGGLISAIVWMVLFVGIFYFLILRPQQQQRKKHEEFLKNLKKGEKVITTGGIIGEI 61

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSE 100
            + I++  + +++ E   ++V++  ++ 
Sbjct: 62  -KNIEEKTVSLKVCEGCIIKVLKPSIAS 88


>gi|220916515|ref|YP_002491819.1| preprotein translocase subunit YajC [Anaeromyxobacter
          dehalogenans 2CP-1]
 gi|219954369|gb|ACL64753.1| preprotein translocase, YajC subunit [Anaeromyxobacter
          dehalogenans 2CP-1]
          Length = 115

 Score = 85.9 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 55/99 (55%), Gaps = 1/99 (1%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          M   ++A     A   A +P+     F  +AVV+YF+  RPQ +Q +     +  L++GD
Sbjct: 1  MHPVLHAFLSQTADGQAQNPIVAFLPFIAIAVVFYFVFFRPQAKQAKAHQAFVTALKKGD 60

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVS 99
           +VT +GI+G VV V +D  + +++    ++RV++  V+
Sbjct: 61 EVVTQSGIIGTVVLV-EDRTVTIDVGAGTKLRVLKGQVA 98


>gi|255531307|ref|YP_003091679.1| preprotein translocase subunit YajC [Pedobacter heparinus DSM 2366]
 gi|255344291|gb|ACU03617.1| preprotein translocase, YajC subunit [Pedobacter heparinus DSM
           2366]
          Length = 109

 Score = 85.9 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 56/111 (50%), Gaps = 12/111 (10%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +T+  Q+           L       ++ VV+YF +IRPQ ++ +   +M+  L++GD
Sbjct: 1   MISTIILQAQ------GNGMLSTLVPMVLIMVVFYFFMIRPQVKKAKDLKKMVEALKKGD 54

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVS-----EVQSKSE 106
            IVT AGI G++  + +   L +E+    ++R  ++ VS      V  K+E
Sbjct: 55  KIVTTAGIHGRIADMNETTFL-IEVEGGTKIRFDKTAVSLDATKAVAPKTE 104


>gi|323702059|ref|ZP_08113727.1| preprotein translocase, YajC subunit [Desulfotomaculum nigrificans
           DSM 574]
 gi|323532941|gb|EGB22812.1| preprotein translocase, YajC subunit [Desulfotomaculum nigrificans
           DSM 574]
          Length = 94

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
               M      L  + YFL+IRPQ+++ ++ A M+  L+ GD+I+T  G++G ++++ + 
Sbjct: 5   GSAGMIIYLVALFAILYFLMIRPQQKRQKQHAAMINALKVGDNIITVGGLLGSIIKIKE- 63

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSK 104
             + + +A+ V + ++++ +S+V  K
Sbjct: 64  NTVILRVADKVHIEILKNAISQVTEK 89


>gi|154173710|ref|YP_001408527.1| preprotein translocase subunit YajC [Campylobacter curvus 525.92]
 gi|112803073|gb|EAU00417.1| preprotein translocase, YajC subunit [Campylobacter curvus 525.92]
          Length = 92

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            + +       VL  ++YFL+IRPQ++Q +  A+ML  L +GD I+T  G++ +V++  +
Sbjct: 4   GNFVASLLPLIVLFAIFYFLVIRPQQKQQKAHAKMLSELEKGDKIITNGGLICEVIKPEE 63

Query: 78  DLELEVEIAENVRVRVVRSFVSE 100
           D  ++V++ ++V VRV R F++ 
Sbjct: 64  DF-IKVKLNDDVIVRVSREFIAR 85


>gi|227550879|ref|ZP_03980928.1| preprotein translocase, YajC subunit [Enterococcus faecium TX1330]
 gi|227179977|gb|EEI60949.1| preprotein translocase, YajC subunit [Enterococcus faecium TX1330]
          Length = 140

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +
Sbjct: 15  MGSLPMLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDN 73

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           D    V   E + +   R+ +  V+ 
Sbjct: 74  DKRTVVLDCEGIFLEYDRAAIKTVKP 99


>gi|184154994|ref|YP_001843334.1| hypothetical protein LAF_0518 [Lactobacillus fermentum IFO 3956]
 gi|260663389|ref|ZP_05864280.1| translocase subunit yajC [Lactobacillus fermentum 28-3-CHN]
 gi|183226338|dbj|BAG26854.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|260552241|gb|EEX25293.1| translocase subunit yajC [Lactobacillus fermentum 28-3-CHN]
          Length = 140

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 38/81 (46%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +    L  ++    YF +IRPQ++Q +    M+  L+ GD++VT   + G V  V    +
Sbjct: 5   MSSIILIVLMIAFMYFFMIRPQQRQRKEHQAMVNQLKPGDAVVTIGRLHGMVHEVNTAEQ 64

Query: 81  LEVEIAENVRVRVVRSFVSEV 101
                 E + +    S V++V
Sbjct: 65  TVTIDCEGIYLTFDLSAVAKV 85


>gi|154686911|ref|YP_001422072.1| preprotein translocase subunit YajC [Bacillus amyloliquefaciens
           FZB42]
 gi|154352762|gb|ABS74841.1| YrbF [Bacillus amyloliquefaciens FZB42]
          Length = 86

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++  V YFLLIRPQ++Q +   +M   L++GDS+VT  G+ G V  + D
Sbjct: 1   MGTLGTIVPIILMFAVLYFLLIRPQQKQQKAVRQMQEELKKGDSVVTIGGLHGTVESI-D 59

Query: 78  DLELEVEIAENVRVRVVRSFVSE 100
           + ++ ++  +N R+   R  + E
Sbjct: 60  ESKVVIKTGDNTRLTFDRRAIRE 82


>gi|85708078|ref|ZP_01039144.1| preprotein translocase, YajC subunit [Erythrobacter sp. NAP1]
 gi|85689612|gb|EAQ29615.1| preprotein translocase, YajC subunit [Erythrobacter sp. NAP1]
          Length = 106

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                    + V+++FL+IRPQ ++ +     +  L++GD +VT  G+VGKV++V DD  
Sbjct: 17  WINWLPIIGMVVIFWFLIIRPQMKRQKEHQAKVAGLKKGDQVVTQGGLVGKVMKV-DDTY 75

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
            E+E+A++VRV+ V+  ++++    
Sbjct: 76  AEIELAKDVRVKAVKHTIADLIEPG 100


>gi|167647071|ref|YP_001684734.1| preprotein translocase subunit YajC [Caulobacter sp. K31]
 gi|167349501|gb|ABZ72236.1| preprotein translocase, YajC subunit [Caulobacter sp. K31]
          Length = 102

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
                + L       ++ V++YF+LIRPQ+ + ++ A  +  ++RGD++V + G++GKVV
Sbjct: 2   SGGLQAQLIQIAPIVLMVVLFYFMLIRPQQTRAKQHAAAIAAVKRGDNVVLSNGMLGKVV 61

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           RV +D E+ VEIA+ V V+VV+S ++E+++K EP
Sbjct: 62  RV-EDAEVGVEIAQGVTVKVVKSMIAEIRAKGEP 94


>gi|229918410|ref|YP_002887056.1| preprotein translocase, YajC subunit [Exiguobacterium sp. AT1b]
 gi|229469839|gb|ACQ71611.1| preprotein translocase, YajC subunit [Exiguobacterium sp. AT1b]
          Length = 95

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       ++ VV+YFLLIRPQ ++ +    M   L RGDS+VT  G+ G VV  I+D  
Sbjct: 7   IVALLPMILIFVVFYFLLIRPQTKRQKEVQAMQNALERGDSVVTIGGLHG-VVHQIEDTH 65

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS 105
           + ++  +   +R  RS V+EV  K+
Sbjct: 66  VVLK-CDQSLLRFNRSAVAEVVKKA 89


>gi|302871037|ref|YP_003839673.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302573896|gb|ADL41687.1| preprotein translocase, YajC subunit [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 121

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 59/113 (52%), Gaps = 6/113 (5%)

Query: 1   MFTTVYAQSDAPAITSATSPLE------MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLR 54
           +    YA  +  +   A +               ++ VV Y L+I PQR++ ++  EM+ 
Sbjct: 7   LLEIAYAAGNQSSQQQAPAGATALALLAQFIPLILMFVVLYLLIIVPQRRREKQFREMIN 66

Query: 55  NLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +L  GD IVT AGI+GK+V + DD+      A+ V++++ +  V EV  K+EP
Sbjct: 67  SLIVGDEIVTNAGIIGKIVNIKDDILTIEVGADRVKLKIYKWAVKEVLKKAEP 119


>gi|227514532|ref|ZP_03944581.1| protein translocase subunit YajC [Lactobacillus fermentum ATCC
           14931]
 gi|227087089|gb|EEI22401.1| protein translocase subunit YajC [Lactobacillus fermentum ATCC
           14931]
          Length = 136

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 38/81 (46%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +    L  ++    YF +IRPQ++Q +    M+  L+ GD++VT   + G V  V    +
Sbjct: 1   MSSIILIVLMIAFMYFFMIRPQQRQRKEHQAMVNQLKPGDAVVTIGRLHGMVHEVNTAEQ 60

Query: 81  LEVEIAENVRVRVVRSFVSEV 101
                 E + +    S V++V
Sbjct: 61  TVTIDCEGIYLTFDLSAVAKV 81


>gi|282858296|ref|ZP_06267481.1| preprotein translocase, YajC subunit [Prevotella bivia
          JCVIHMP010]
 gi|282588927|gb|EFB94047.1| preprotein translocase, YajC subunit [Prevotella bivia
          JCVIHMP010]
          Length = 107

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
          A  + +    M  +   + V+ YF +IRPQ+++ +        L+ GDS+VT  GI G V
Sbjct: 8  AGQAQSGGFPMILMMVAIFVIMYFFMIRPQQKKQKEIRAFQNALKEGDSVVTGGGIYGTV 67

Query: 73 VRVI-DDLELEVEIAENVRVRVVRSFV 98
           R+     ++++EIA  V + V + +V
Sbjct: 68 KRIDLTTGKIDIEIARGVVITVDKGYV 94


>gi|169829374|ref|YP_001699532.1| hypothetical protein Bsph_3932 [Lysinibacillus sphaericus C3-41]
 gi|168993862|gb|ACA41402.1| UPF0092 membrane protein [Lysinibacillus sphaericus C3-41]
          Length = 87

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++ V  +F+LIRP +++ Q    M  +L+RGD ++T  G+ G V+  I+
Sbjct: 1   MDQLLGLAPILLMFVAMWFILIRPAKKRQQETQNMQGSLQRGDKVITIGGLHG-VIDAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEV 101
           D  + ++IA+NVRV+  R  +  V
Sbjct: 60  DTAVTLKIADNVRVKFDRQAIGRV 83


>gi|172058103|ref|YP_001814563.1| preprotein translocase, YajC subunit [Exiguobacterium sibiricum
           255-15]
 gi|171990624|gb|ACB61546.1| preprotein translocase, YajC subunit [Exiguobacterium sibiricum
           255-15]
          Length = 96

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 52/88 (59%), Gaps = 2/88 (2%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L       ++ VV+YFLLIRPQ ++ ++  EM   L RGDSIVT  G+ G V +V D+  
Sbjct: 4   LLTFLPMILIFVVFYFLLIRPQNKRQKQVREMQTQLSRGDSIVTIGGLHGVVQKV-DETT 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           + ++ + N ++   RS V+EV  K+  V
Sbjct: 63  VTLK-SGNAQLTFNRSAVAEVTKKTTTV 89


>gi|293556914|ref|ZP_06675475.1| preprotein translocase subunit YajC [Enterococcus faecium E1039]
 gi|294618015|ref|ZP_06697618.1| preprotein translocase subunit YajC [Enterococcus faecium E1679]
 gi|291595730|gb|EFF27020.1| preprotein translocase subunit YajC [Enterococcus faecium E1679]
 gi|291600998|gb|EFF31289.1| preprotein translocase subunit YajC [Enterococcus faecium E1039]
          Length = 126

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +
Sbjct: 1   MGTLPMLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDN 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           D    V   E + +   R+ +  V+ 
Sbjct: 60  DKRTVVLDCEGIFLEYDRAAIKTVKP 85


>gi|258615065|ref|ZP_05712835.1| preprotein translocase, YajC subunit, putative [Enterococcus
           faecium DO]
 gi|293560284|ref|ZP_06676781.1| preprotein translocase subunit YajC [Enterococcus faecium E1162]
 gi|293567783|ref|ZP_06679124.1| preprotein translocase subunit YajC [Enterococcus faecium E1071]
 gi|294620897|ref|ZP_06700098.1| preprotein translocase subunit YajC [Enterococcus faecium U0317]
 gi|314938955|ref|ZP_07846220.1| preprotein translocase, YajC subunit [Enterococcus faecium
           TX0133a04]
 gi|314943494|ref|ZP_07850261.1| preprotein translocase, YajC subunit [Enterococcus faecium TX0133C]
 gi|314948211|ref|ZP_07851605.1| preprotein translocase, YajC subunit [Enterococcus faecium TX0082]
 gi|314951572|ref|ZP_07854618.1| preprotein translocase, YajC subunit [Enterococcus faecium TX0133A]
 gi|314991566|ref|ZP_07857042.1| preprotein translocase, YajC subunit [Enterococcus faecium TX0133B]
 gi|314994899|ref|ZP_07860026.1| preprotein translocase, YajC subunit [Enterococcus faecium
           TX0133a01]
 gi|291589368|gb|EFF21175.1| preprotein translocase subunit YajC [Enterococcus faecium E1071]
 gi|291599508|gb|EFF30524.1| preprotein translocase subunit YajC [Enterococcus faecium U0317]
 gi|291605734|gb|EFF35171.1| preprotein translocase subunit YajC [Enterococcus faecium E1162]
 gi|313590881|gb|EFR69726.1| preprotein translocase, YajC subunit [Enterococcus faecium
           TX0133a01]
 gi|313593850|gb|EFR72695.1| preprotein translocase, YajC subunit [Enterococcus faecium TX0133B]
 gi|313596266|gb|EFR75111.1| preprotein translocase, YajC subunit [Enterococcus faecium TX0133A]
 gi|313597866|gb|EFR76711.1| preprotein translocase, YajC subunit [Enterococcus faecium TX0133C]
 gi|313641664|gb|EFS06244.1| preprotein translocase, YajC subunit [Enterococcus faecium
           TX0133a04]
 gi|313645344|gb|EFS09924.1| preprotein translocase, YajC subunit [Enterococcus faecium TX0082]
          Length = 126

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +
Sbjct: 1   MGTLPMLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDN 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           D    V   E + +   R+ +  V+ 
Sbjct: 60  DKRTVVLDCEGIFLEYDRAAIKTVKP 85


>gi|284048858|ref|YP_003399197.1| preprotein translocase, YajC subunit [Acidaminococcus fermentans
           DSM 20731]
 gi|283953079|gb|ADB47882.1| preprotein translocase, YajC subunit [Acidaminococcus fermentans
           DSM 20731]
          Length = 122

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 56/89 (62%), Gaps = 1/89 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             + L+MA  F ++ V++Y ++ RPQ++  ++R EML +L+ G +IVT  GI+G + +V 
Sbjct: 1   MDNLLQMAWPFILMGVIFYVMIYRPQKRDQKKRTEMLDSLKVGTNIVTIGGILGTITKVQ 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +D  + +++AE V   + +S V  V + +
Sbjct: 61  EDK-VRIKVAEGVEFHIRKSAVGGVITSA 88


>gi|254419899|ref|ZP_05033623.1| preprotein translocase, YajC subunit [Brevundimonas sp. BAL3]
 gi|196186076|gb|EDX81052.1| preprotein translocase, YajC subunit [Brevundimonas sp. BAL3]
          Length = 105

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            APA     + +        + +++YFLLIRPQ+++ +  A  +  ++RGD++V ++G++
Sbjct: 2   GAPADGGMMAVIMQFLPIVAIFILFYFLLIRPQQKRAKEHAAAIGAVKRGDTVVLSSGMI 61

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           GKV RV ++ E+ VEIA +V VRVV++ ++EV++++
Sbjct: 62  GKVTRV-EEAEVNVEIAPSVNVRVVKTMIAEVRNRT 96


>gi|261207144|ref|ZP_05921833.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289565265|ref|ZP_06445716.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|294615095|ref|ZP_06694981.1| preprotein translocase subunit YajC [Enterococcus faecium E1636]
 gi|260078772|gb|EEW66474.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289162921|gb|EFD10770.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|291592037|gb|EFF23660.1| preprotein translocase subunit YajC [Enterococcus faecium E1636]
          Length = 126

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +
Sbjct: 1   MGTLPMLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDN 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           D    V   E + +   R+ +  V+ 
Sbjct: 60  DKRTVVLDCEGIFLEYDRAAIKTVKP 85


>gi|227888710|ref|ZP_04006515.1| preprotein translocase subunit YajC [Lactobacillus johnsonii ATCC
           33200]
 gi|227850737|gb|EEJ60823.1| preprotein translocase subunit YajC [Lactobacillus johnsonii ATCC
           33200]
          Length = 151

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 32  VVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRV 91
           V +YF +I+PQ++Q Q R +M+  L++GD ++   G+ GKV  + D  +  V  A+ + +
Sbjct: 32  VFFYFSMIKPQKKQQQERMKMMSELKKGDQVIMVDGLHGKVDSINDSDKTVVIDADGIFL 91

Query: 92  RVVRSFVSEVQS 103
              R  +  V  
Sbjct: 92  TFERMAIRRVLP 103


>gi|289548141|ref|YP_003473129.1| preprotein translocase, YajC subunit [Thermocrinis albus DSM
          14484]
 gi|289181758|gb|ADC89002.1| preprotein translocase, YajC subunit [Thermocrinis albus DSM
          14484]
          Length = 109

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 2/100 (2%)

Query: 1  MFTTVYAQSDAP-AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
          M    YAQ  AP      ++ L     F  L  ++YFLLIRPQ++  +R  E L  L++G
Sbjct: 1  MVKMAYAQQGAPHGSDPLSALLFQFVFFLFLMAIFYFLLIRPQQKARKRHQEFLAGLKKG 60

Query: 60 DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVS 99
          + +VT+ GI+G VV + +   + + +  N RV  ++  + 
Sbjct: 61 ERVVTSGGIIGTVVEIGE-KTVTLRVDANTRVTFLKENIV 99


>gi|126654015|ref|ZP_01725848.1| preprotein translocase subunit YajC [Bacillus sp. B14905]
 gi|126589489|gb|EAZ83633.1| preprotein translocase subunit YajC [Bacillus sp. B14905]
          Length = 87

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++ V  +F+LIRP +++ Q    M  +L+RGD ++T  G+ G V+  I+
Sbjct: 1   MDQLLGLAPILLMFVAMWFILIRPAKKRQQETQNMQGSLQRGDKVITIGGMHG-VIDAIE 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEV 101
           D  + ++IA+NVRV+  R  +  V
Sbjct: 60  DTSVTLKIADNVRVKFDRQAIGRV 83


>gi|121611004|ref|YP_998811.1| preprotein translocase subunit YajC [Verminephrobacter eiseniae
           EF01-2]
 gi|121555644|gb|ABM59793.1| protein translocase subunit yajC [Verminephrobacter eiseniae
           EF01-2]
          Length = 91

 Score = 85.2 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             S L    L   + VV Y ++IRPQ ++ +    M+  L RGD + T  GIVG+V R+ 
Sbjct: 1   MMSMLSSLALPAAMMVVLYLVMIRPQMRRQKEHRTMIEALARGDEVATTGGIVGRVTRLS 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +   L+VEIA  V V++ RS V +V  K 
Sbjct: 61  EGF-LQVEIAPGVEVQMQRSAVVQVLPKG 88


>gi|86133165|ref|ZP_01051747.1| preprotein translocase subunit [Polaribacter sp. MED152]
 gi|85820028|gb|EAQ41175.1| preprotein translocase subunit [Polaribacter sp. MED152]
          Length = 97

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI- 76
           +  L     F  + +V YF +IRPQ Q+ ++       +++G  ++TA+GI GK+V +  
Sbjct: 3   SGSLASMLPFLAMILVLYFFMIRPQMQRQKKEKAFQAEIKKGTRVITASGIHGKIVEINA 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSK 104
            D  + +E     +++  RS +S   SK
Sbjct: 63  TDNTITLETGAG-KIKFERSAISMELSK 89


>gi|268318976|ref|YP_003292632.1| hypothetical protein FI9785_485 [Lactobacillus johnsonii FI9785]
 gi|262397351|emb|CAX66365.1| yajC [Lactobacillus johnsonii FI9785]
          Length = 151

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 32  VVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRV 91
           V +YF +I+PQ++Q Q R +M+  L++GD ++   G+ GKV  + D  +  V  A+ + +
Sbjct: 32  VFFYFSMIKPQKKQQQERMKMMSELKKGDQVIMVDGLHGKVDSINDSDKTVVIDADGIFL 91

Query: 92  RVVRSFVSEVQS 103
              R  +  V  
Sbjct: 92  TFERMAIRRVLP 103


>gi|256847963|ref|ZP_05553407.1| preprotein translocase subunit [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715023|gb|EEU30000.1| preprotein translocase subunit [Lactobacillus coleohominis
           101-4-CHN]
          Length = 137

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 38/85 (44%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           +  +    L  ++ V  YF +IRPQ++Q +    M+  L+ GD +VT + + G V  V +
Sbjct: 3   SQGMSSIILIVLMVVFMYFFMIRPQQKQRKEHQAMMSKLQPGDHVVTISRLHGVVSEVNE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQ 102
             +      E + +      V  V 
Sbjct: 63  KEQTVTLDCEGIYLTFDLVAVQRVV 87


>gi|293573013|ref|ZP_06683955.1| preprotein translocase subunit YajC [Enterococcus faecium E980]
 gi|291606915|gb|EFF36295.1| preprotein translocase subunit YajC [Enterococcus faecium E980]
          Length = 126

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +
Sbjct: 1   MGSLPMLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDN 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           D    V   E + +   R+ +  V+ 
Sbjct: 60  DKRTVVIDCEGIFLEYDRAAIKTVKP 85


>gi|150021769|ref|YP_001307123.1| preprotein translocase, YajC subunit [Thermosipho melanesiensis
           BI429]
 gi|149794290|gb|ABR31738.1| preprotein translocase, YajC subunit [Thermosipho melanesiensis
           BI429]
          Length = 116

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 62/103 (60%), Gaps = 1/103 (0%)

Query: 4   TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIV 63
           +    + + A ++A+   +M  L  +  V+ YFL+I PQR++ ++  +M+  ++RGD+I+
Sbjct: 13  SAAGNTTSAAPSAASGLFQMLFLLLIFFVMMYFLVILPQRKREKQFKKMISQIKRGDTII 72

Query: 64  TAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           T+ GI+GKV+ V  D  L+++ +    + + + ++S+V    E
Sbjct: 73  TSGGIIGKVIDVKKD-TLKIKTSNTTELEISKLYISKVIKNKE 114


>gi|304382449|ref|ZP_07364947.1| preprotein translocase [Prevotella marshii DSM 16973]
 gi|304336402|gb|EFM02640.1| preprotein translocase [Prevotella marshii DSM 16973]
          Length = 102

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
          A  +      M  +   +  ++YF +IRPQ+++ +       +L  G  +VT  GI G V
Sbjct: 4  AAQAQGGGTGMILMMVAIFAIFYFFMIRPQQKKQKEIRTFQNSLAEGAKVVTGGGIYGIV 63

Query: 73 VRVI-DDLELEVEIAENVRVRVVRSFV 98
            V  +  ++EVEIA    +RV ++ V
Sbjct: 64 KHVDTETNQVEVEIARGTVIRVDKASV 90


>gi|160893295|ref|ZP_02074082.1| hypothetical protein CLOL250_00844 [Clostridium sp. L2-50]
 gi|156864987|gb|EDO58418.1| hypothetical protein CLOL250_00844 [Clostridium sp. L2-50]
          Length = 118

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           S +    + +S + +     + A + YF++IRPQ++Q  +  EM   +  GD+I+T +G 
Sbjct: 9   SGSTPANTGSSTMFIVVYILIFAAIIYFMMIRPQKKQKAKTEEMHNQMEPGDNIMTTSGF 68

Query: 69  VGKVVRVIDDLELEVE--IAENVRVRVVRSFVSEVQSKSEPV 108
            G ++ ++DD  + VE    +N R+ + ++ V+E++ K+  V
Sbjct: 69  YGTILDIVDDTTIIVEFGNNKNCRIPMHKNAVAELEKKNAAV 110


>gi|160887368|ref|ZP_02068371.1| hypothetical protein BACOVA_05387 [Bacteroides ovatus ATCC 8483]
 gi|237722650|ref|ZP_04553131.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|260171338|ref|ZP_05757750.1| hypothetical protein BacD2_05680 [Bacteroides sp. D2]
 gi|262407254|ref|ZP_06083802.1| preprotein translocase subunit [Bacteroides sp. 2_1_22]
 gi|293370797|ref|ZP_06617343.1| preprotein translocase, YajC subunit [Bacteroides ovatus SD CMC
          3f]
 gi|294644673|ref|ZP_06722423.1| preprotein translocase, YajC subunit [Bacteroides ovatus SD CC
          2a]
 gi|294809066|ref|ZP_06767788.1| preprotein translocase, YajC subunit [Bacteroides xylanisolvens
          SD CC 1b]
 gi|298482674|ref|ZP_07000858.1| preprotein translocase, YajC subunit [Bacteroides sp. D22]
 gi|299148944|ref|ZP_07042006.1| preprotein translocase, YajC subunit [Bacteroides sp. 3_1_23]
 gi|315919649|ref|ZP_07915889.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156107779|gb|EDO09524.1| hypothetical protein BACOVA_05387 [Bacteroides ovatus ATCC 8483]
 gi|229448460|gb|EEO54251.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262354062|gb|EEZ03154.1| preprotein translocase subunit [Bacteroides sp. 2_1_22]
 gi|292634157|gb|EFF52700.1| preprotein translocase, YajC subunit [Bacteroides ovatus SD CMC
          3f]
 gi|292640007|gb|EFF58275.1| preprotein translocase, YajC subunit [Bacteroides ovatus SD CC
          2a]
 gi|294443791|gb|EFG12536.1| preprotein translocase, YajC subunit [Bacteroides xylanisolvens
          SD CC 1b]
 gi|295087144|emb|CBK68667.1| protein translocase subunit yajC [Bacteroides xylanisolvens XB1A]
 gi|298271137|gb|EFI12714.1| preprotein translocase, YajC subunit [Bacteroides sp. D22]
 gi|298513705|gb|EFI37592.1| preprotein translocase, YajC subunit [Bacteroides sp. 3_1_23]
 gi|313693524|gb|EFS30359.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 107

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 22 EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
           M  +   + V+ YF +IRPQ ++ +  A   ++L+   +++TA GI G +  + DD  +
Sbjct: 20 MMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQNVITAGGIHGTIKEITDD-YI 78

Query: 82 EVEIAENVRVRVVRSFV 98
           +EIA NV++++ ++ +
Sbjct: 79 VLEIASNVKIKIDKNSI 95


>gi|239617982|ref|YP_002941304.1| preprotein translocase, YajC subunit [Kosmotoga olearia TBF 19.5.1]
 gi|239506813|gb|ACR80300.1| preprotein translocase, YajC subunit [Kosmotoga olearia TBF 19.5.1]
          Length = 123

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 55/116 (47%), Gaps = 10/116 (8%)

Query: 1   MFTTVYAQSDAPAITSATSPLEM---------AGLFFVLAVVWYFLLIRPQRQQLQRRAE 51
           MF  +   +  PA    TSP+                ++  ++YF++I PQ+++ ++  E
Sbjct: 1   MFPILGFVAYGPAAPETTSPVPTGATGGFAGIIVWLVIMIGLFYFMIILPQKRRDKKFKE 60

Query: 52  MLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           ++  L+ GD ++T  GI+GKV  + +   + ++      + + R  V+ +  K  P
Sbjct: 61  LMSKLKVGDRVITVGGIIGKVTNIKE-NTVRIKTGNGSEIDIARRSVTAILGKGTP 115


>gi|305664843|ref|YP_003861130.1| YajC [Maribacter sp. HTCC2170]
 gi|88707965|gb|EAR00204.1| YajC [Maribacter sp. HTCC2170]
          Length = 97

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 44/88 (50%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            +  +       ++ VV YF +IRPQ ++ +   +    L+RGD I+T +G+ GKVV + 
Sbjct: 2   GSGSIMDFMPMILIFVVAYFFMIRPQMKRQKDEKKFSAELKRGDRIITKSGLHGKVVDIS 61

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSK 104
           +     V      +++  RS +S   SK
Sbjct: 62  EKDTSCVIETMAGKLKFDRSAISMEMSK 89


>gi|148284958|ref|YP_001249048.1| preprotein translocase subunit YajC [Orientia tsutsugamushi str.
           Boryong]
 gi|189184069|ref|YP_001937854.1| preprotein translocase subunit YajC [Orientia tsutsugamushi str.
           Ikeda]
 gi|146740397|emb|CAM80855.1| preprotein translocase YajC subunit [Orientia tsutsugamushi str.
           Boryong]
 gi|189180840|dbj|BAG40620.1| preprotein translocase, YajC subunit [Orientia tsutsugamushi str.
           Ikeda]
          Length = 126

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID-DL 79
                   ++  V YFLLIRPQ ++ +   +++R +++G+ ++T +GI   +V + +   
Sbjct: 34  WINIIPLVLVFTVVYFLLIRPQEKKRKEHEQLIRTIKKGEQVITTSGIYASIVSIDESTD 93

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSK 104
            + +EIA   +++++R+ +++V S+
Sbjct: 94  IITLEIAPGTKIKILRAAIADVISR 118


>gi|163840740|ref|YP_001625145.1| preprotein translocase, YajC subunit [Renibacterium salmoninarum
           ATCC 33209]
 gi|162954216|gb|ABY23731.1| preprotein translocase, YajC subunit [Renibacterium salmoninarum
           ATCC 33209]
          Length = 153

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 49/104 (47%), Gaps = 3/104 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF+++ A  + PA     +      +   L  V  F + R  R Q + + E    +  G 
Sbjct: 1   MFSSILAADNQPAADGGFNW--SMLILLALFAVVIFFMFRRSRAQQKTQREQQAKMAPGV 58

Query: 61  SIVTAAGIVGKVVRVID-DLELEVEIAENVRVRVVRSFVSEVQS 103
            ++T+ G+ G V+ V + D ++ +E+++     V R  V+++ +
Sbjct: 59  QVMTSFGLFGTVLSVDEADNKVTLELSQGNTATVHRQAVTKIIT 102


>gi|329666841|gb|AEB92789.1| hypothetical protein LJP_0455 [Lactobacillus johnsonii DPC 6026]
          Length = 151

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 32  VVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRV 91
           V +YF +I+PQ++Q Q R +M+  L++GD ++   G+ GKV  + D  +  V  A+ + +
Sbjct: 32  VFFYFSMIKPQKKQQQERMKMMSELKKGDQVIMVDGLHGKVDSINDSDKTVVIDADGIFL 91

Query: 92  RVVRSFVSEVQS 103
              R  +  V  
Sbjct: 92  TFERMAIRRVLP 103


>gi|292670696|ref|ZP_06604122.1| preprotein translocase [Selenomonas noxia ATCC 43541]
 gi|292647642|gb|EFF65614.1| preprotein translocase [Selenomonas noxia ATCC 43541]
          Length = 94

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L   G   +L + +YFLL RPQ+Q  ++R EML  L+ GD+I+T  G+ G +  + D+  
Sbjct: 9   LSSWGPIIILVLFFYFLLYRPQKQAQKKREEMLSRLKTGDAIITLGGMHGTITAL-DEKT 67

Query: 81  LEVEIAENVRVRVVRSFVSEV 101
           + + IAE + V   RS +S V
Sbjct: 68  VTLRIAEGIDVVFERSAISAV 88


>gi|225873736|ref|YP_002755195.1| preprotein translocase, YajC subunit [Acidobacterium capsulatum
           ATCC 51196]
 gi|225792243|gb|ACO32333.1| preprotein translocase, YajC subunit [Acidobacterium capsulatum
           ATCC 51196]
          Length = 117

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 54/93 (58%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
            ++  + +     F  + +V+YFLLIRP + + ++  +ML +L+ GD I T  GI G ++
Sbjct: 22  ASALPAGVTELLPFLFIILVFYFLLIRPNQNRQKKWQQMLSSLKAGDRITTTGGIRGVIL 81

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + DD+       +NVR+ VV+S ++ V ++ E
Sbjct: 82  SIKDDVVQIRVAPDNVRLEVVKSAIAAVTTQDE 114


>gi|256828491|ref|YP_003157219.1| preprotein translocase subunit YajC [Desulfomicrobium baculatum DSM
           4028]
 gi|256577667|gb|ACU88803.1| preprotein translocase, YajC subunit [Desulfomicrobium baculatum
           DSM 4028]
          Length = 118

 Score = 84.8 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query: 1   MF--TTVYAQSDAPAITSA-TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           MF     +A   APA      +PL       ++ V++YFLLIRPQ+++ +   +ML NL 
Sbjct: 1   MFFENLAHAMGQAPAAGGQPGNPLMTFMPLILMFVIFYFLLIRPQQKKQKEHKQMLENLT 60

Query: 58  RGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           RGD +VTA G+ G+VV   +D  L +++  ++ V+V R F+S +  
Sbjct: 61  RGDRVVTAGGLYGRVVEAKED-VLTIDLGNDMHVQVGRGFISGLVP 105


>gi|237713468|ref|ZP_04543949.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|229446450|gb|EEO52241.1| conserved hypothetical protein [Bacteroides sp. D1]
          Length = 104

 Score = 84.8 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 22 EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
           M  +   + V+ YF +IRPQ ++ +  A   ++L+   +++TA GI G +  + DD  +
Sbjct: 17 MMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQNVITAGGIHGTIKEITDD-YI 75

Query: 82 EVEIAENVRVRVVRSFV 98
           +EIA NV++++ ++ +
Sbjct: 76 VLEIASNVKIKIDKNSI 92


>gi|51244761|ref|YP_064645.1| hypothetical protein DP0909 [Desulfotalea psychrophila LSv54]
 gi|50875798|emb|CAG35638.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 110

 Score = 84.8 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 21 LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
          L       ++ VV+YFLLIRPQ++Q ++    L  L++G  I+T  GI G +  + +D  
Sbjct: 17 LTSFIPLILIFVVFYFLLIRPQQKQAKQHQLFLSELKKGQKILTKGGIYGTITAL-NDNV 75

Query: 81 LEVEIAENVRVRVVRSFVS 99
          + +EIA+++ ++V R  V+
Sbjct: 76 ITLEIAKDISIKVSRDAVA 94


>gi|260558428|ref|ZP_05830624.1| predicted protein [Enterococcus faecium C68]
 gi|260075602|gb|EEW63908.1| predicted protein [Enterococcus faecium C68]
          Length = 129

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +
Sbjct: 4   MGTLPMLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDN 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           D    V   E + +   R+ +  V+ 
Sbjct: 63  DKRTVVLDCEGIFLEYDRAAIKTVKP 88


>gi|320536405|ref|ZP_08036444.1| preprotein translocase, YajC subunit [Treponema phagedenis F0421]
 gi|320146747|gb|EFW38324.1| preprotein translocase, YajC subunit [Treponema phagedenis F0421]
          Length = 139

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             +      M      +  ++YF +I PQ+++ ++  EM+  L++GD ++T  GI G VV
Sbjct: 8   QAAQGGSWIMMVSLGAVIAIFYFFVIGPQKKEQKKTQEMINALQKGDKVITIGGIHG-VV 66

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
               D  + +++ +N ++ V R+ +  V 
Sbjct: 67  SSAKDKTVIIKVDDNCKLEVNRTAIGTVI 95


>gi|317153241|ref|YP_004121289.1| preprotein translocase subunit YajC [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943492|gb|ADU62543.1| preprotein translocase, YajC subunit [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 116

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 26  LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEI 85
           +  ++  ++YFLLIRPQ+++ +    ML  LR+GD + T  GI+G +V +  D  L +EI
Sbjct: 32  MLVLMFAIFYFLLIRPQQKKQKLHKAMLDALRKGDKVWTNGGILGVIVDIDGDN-LTIEI 90

Query: 86  AENVRVRVVRSFVSE 100
           A  V V + R FV++
Sbjct: 91  AAGVNVVIKRGFVAD 105


>gi|320528875|ref|ZP_08029967.1| preprotein translocase, YajC subunit [Selenomonas artemidis F0399]
 gi|320138505|gb|EFW30395.1| preprotein translocase, YajC subunit [Selenomonas artemidis F0399]
          Length = 94

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              + L   G   +L V +YFLL RPQ+Q  ++R EML  L  G+++VT  G+ G +  +
Sbjct: 4   QMMAQLSSWGPIVILVVFFYFLLYRPQKQAQKKREEMLSRLAVGNAVVTLGGMHGTITAL 63

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSK 104
            D+  + +  AE V +   RS +S V S+
Sbjct: 64  -DEKTVTLRAAEGVDIVFERSAISAVVSE 91


>gi|42518565|ref|NP_964495.1| hypothetical protein LJ0469 [Lactobacillus johnsonii NCC 533]
 gi|41582850|gb|AAS08461.1| hypothetical protein LJ_0469 [Lactobacillus johnsonii NCC 533]
          Length = 146

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 5/103 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M T   AQS A       + + M      + V +YF +I+PQ++Q Q R +M+  L++GD
Sbjct: 1   MNTFFLAQSAA-----GMNNIFMIIAMIAIFVFFYFSMIKPQKKQQQERMKMMSELKKGD 55

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            ++   G+ GKV  + D  +  V  A+ + +   R  +  V  
Sbjct: 56  QVIMVDGLHGKVDSINDSDKTVVIDADGIFLTFERMAIRRVLP 98


>gi|157736655|ref|YP_001489338.1| preprotein translocase subunit [Arcobacter butzleri RM4018]
 gi|157698509|gb|ABV66669.1| preprotein translocase subunit [Arcobacter butzleri RM4018]
          Length = 87

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
             +        L  ++YFL+IRPQ++Q +   +M+ NL++GD IVT  G++ +VV+V ++
Sbjct: 3   DLVSSLLPLVALFAIFYFLIIRPQQKQAKAHRDMVANLKKGDKIVTNGGLMVEVVKV-EE 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQ 102
               V+  +   +++V+ FV+++ 
Sbjct: 62  TYFLVKNNDGSEMKLVKEFVAKLL 85


>gi|303238042|ref|ZP_07324583.1| preprotein translocase, YajC subunit [Prevotella disiens
          FB035-09AN]
 gi|302481738|gb|EFL44792.1| preprotein translocase, YajC subunit [Prevotella disiens
          FB035-09AN]
          Length = 110

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 10 DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
           A A   +   + M  +  ++  + +F +IRPQ+++ ++       L+ GDS+VT  GI 
Sbjct: 8  AAQAAGQSGGAMPMIVMMILIFAIMWFFMIRPQQKKQKQIRAFQNALKEGDSVVTGGGIF 67

Query: 70 GKVVRVI-DDLELEVEIAENVRVRVVRSFV 98
          G V RV     +++VEIA  V + V + +V
Sbjct: 68 GIVKRVDLTANKIDVEIARGVVISVDKGYV 97


>gi|153807763|ref|ZP_01960431.1| hypothetical protein BACCAC_02046 [Bacteroides caccae ATCC 43185]
 gi|149129372|gb|EDM20586.1| hypothetical protein BACCAC_02046 [Bacteroides caccae ATCC 43185]
          Length = 107

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 22 EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
           M  +   + V+ YF +IRPQ ++ +  A   ++L+   S++TA GI G +  + DD  +
Sbjct: 20 MMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQSVITAGGIHGTIKEITDD-YI 78

Query: 82 EVEIAENVRVRVVRSFV 98
           +EIA NV++++ ++ +
Sbjct: 79 VLEIASNVKIKIDKNSI 95


>gi|257460761|ref|ZP_05625862.1| preprotein translocase, YajC subunit [Campylobacter gracilis
           RM3268]
 gi|257442092|gb|EEV17234.1| preprotein translocase, YajC subunit [Campylobacter gracilis
           RM3268]
          Length = 90

 Score = 84.8 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             +         V+  + YFL+IRPQ++Q +    M+  L +GD I+T+ GI   VV+  
Sbjct: 3   QGNFFASILPIVVIFAIMYFLIIRPQQKQAKDHKAMVDALGKGDKIITSGGIKCTVVKTN 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQ 102
           +D  + V++ + V V + + FV+   
Sbjct: 63  NDF-ITVKLNDEVMVELDKQFVARKL 87


>gi|307298262|ref|ZP_07578066.1| preprotein translocase, YajC subunit [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306916348|gb|EFN46731.1| preprotein translocase, YajC subunit [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 130

 Score = 84.4 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 1/100 (1%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A S  P   ++     +     ++   +YFL+I PQR++ ++  +M+  L+ GD IVTA 
Sbjct: 18  APSTDPGAATSGGFSGIIIWLVLMVAFFYFLIIMPQRKRDKQFKQMMEKLKVGDRIVTAG 77

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           GI+GK+  +  D  L +       + V R  ++ V +K E
Sbjct: 78  GIIGKITMIKPDS-LRIRTGTGTELDVTRKAIAVVVNKGE 116


>gi|310779459|ref|YP_003967792.1| preprotein translocase, YajC subunit [Ilyobacter polytropus DSM
           2926]
 gi|309748782|gb|ADO83444.1| preprotein translocase, YajC subunit [Ilyobacter polytropus DSM
           2926]
          Length = 101

 Score = 84.4 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           + A       +   M     V A V+YFLLIRP +++ ++  EM+ +L  G  I+TA GI
Sbjct: 7   TYAADGAKPANYTGMIVTVVVWAAVFYFLLIRPNKKKQKQHQEMMSSLHAGTQIITAGGI 66

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
            G+VV V D+  + + + + V + + +S ++ V SK
Sbjct: 67  KGEVVSVNDEF-VVIRVDKGVNLTMKKSSIANVYSK 101


>gi|257439753|ref|ZP_05615508.1| preprotein translocase, YajC subunit [Faecalibacterium prausnitzii
           A2-165]
 gi|257197773|gb|EEU96057.1| preprotein translocase, YajC subunit [Faecalibacterium prausnitzii
           A2-165]
          Length = 106

 Score = 84.4 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S + +     ++ V+ YF++ RPQ++Q ++ A M   L  GD +VT  GIVG+VV + DD
Sbjct: 10  SYISLFFTLALMLVLLYFMIYRPQKKQEKKDAAMRAALEIGDQVVTIGGIVGRVVAIKDD 69

Query: 79  LELEVEIAENVRVRVVRSFVSEV 101
             +    ++ V++R  ++ +S V
Sbjct: 70  TFVLETGSDRVKIRFTKNAISSV 92


>gi|260062177|ref|YP_003195257.1| YajC [Robiginitalea biformata HTCC2501]
 gi|88783739|gb|EAR14910.1| YajC [Robiginitalea biformata HTCC2501]
          Length = 95

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 44/88 (50%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            +  +       ++  V YF +IRPQ ++ +   +  + L++GD IVT +G+ GKVV + 
Sbjct: 1   MSDQIGQFLPMILIFAVAYFFMIRPQIKRQKDEKKFAKALKKGDKIVTKSGLYGKVVDLN 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSK 104
           D     +      R++  RS +S   SK
Sbjct: 61  DKDFSCIIETMAGRMKFDRSAISMELSK 88


>gi|311742332|ref|ZP_07716141.1| preprotein translocase [Aeromicrobium marinum DSM 15272]
 gi|311313960|gb|EFQ83868.1| preprotein translocase [Aeromicrobium marinum DSM 15272]
          Length = 103

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       ++A+V++ LL+RP R++ +    + + +  G  I+TA+GI G V  V+DD  
Sbjct: 1   MANFLPLVLIALVFWLLLVRPARKRQKEFTAVQQAIEPGREIMTASGIFGTVTGVVDD-R 59

Query: 81  LEVEIAENVRVRVVRSFVSEVQ--SKSEP 107
           L+VEIA  V + ++R  V  V      EP
Sbjct: 60  LQVEIAPGVTIEILRQAVGRVVDDPAEEP 88


>gi|169824509|ref|YP_001692120.1| hypothetical protein FMG_0812 [Finegoldia magna ATCC 29328]
 gi|302380610|ref|ZP_07269075.1| preprotein translocase, YajC subunit [Finegoldia magna
           ACS-171-V-Col3]
 gi|303233750|ref|ZP_07320404.1| preprotein translocase, YajC subunit [Finegoldia magna BVS033A4]
 gi|167831314|dbj|BAG08230.1| conserved hypothetical protein [Finegoldia magna ATCC 29328]
 gi|302311553|gb|EFK93569.1| preprotein translocase, YajC subunit [Finegoldia magna
           ACS-171-V-Col3]
 gi|302495184|gb|EFL54936.1| preprotein translocase, YajC subunit [Finegoldia magna BVS033A4]
          Length = 102

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 43/81 (53%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            L        L  V YFL+IRPQ++Q ++  +M   ++ GD ++T  G+ G +V V DD 
Sbjct: 4   MLASLLPLIALFAVMYFLMIRPQQKQQKQLMDMRNAIKVGDEVITIGGVKGTIVSVTDDS 63

Query: 80  ELEVEIAENVRVRVVRSFVSE 100
            +    ++  R+  VR+ ++ 
Sbjct: 64  VILETSSQKTRLEFVRNAIAS 84


>gi|161506976|ref|YP_001576930.1| preprotein translocase subunit YajC [Lactobacillus helveticus DPC
           4571]
 gi|160347965|gb|ABX26639.1| Preprotein translocase subunit YajC [Lactobacillus helveticus DPC
           4571]
          Length = 141

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A A  +  S + M  LF VL    YF +IRPQ++Q Q+R +M+  L++GD +V   G+  
Sbjct: 7   ANAGAAGGSNMMMIILFIVLIGFTYFGMIRPQKKQQQQRLQMMDKLKKGDGVVLVDGLHA 66

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           KV ++  D  + V+ A+ + +   R  V  V     PV
Sbjct: 67  KVDKINSDKTIVVD-ADGIYLTFERMAVRRVIPAVAPV 103


>gi|57239505|ref|YP_180641.1| putative preprotein translocase subunit YajC [Ehrlichia ruminantium
           str. Welgevonden]
 gi|57161584|emb|CAH58512.1| putative preprotein translocase subunit YajC [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 122

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI-DDL 79
           +       ++  V+YF +IRPQ+++++   ++L ++++GD ++ +  I G V +V     
Sbjct: 25  IAGLVPLVLIFCVFYFFIIRPQQKKIKEHNKLLESIKKGDKVIISNSIFGIVTKVDATGG 84

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSK 104
              VE++E V ++V++S +SEV  K
Sbjct: 85  HFFVEVSEGVELKVLKSSISEVLDK 109


>gi|300775937|ref|ZP_07085797.1| preprotein translocase [Chryseobacterium gleum ATCC 35910]
 gi|300505487|gb|EFK36625.1| preprotein translocase [Chryseobacterium gleum ATCC 35910]
          Length = 119

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                 S   M  +  V+ V +YFL+IRPQ ++ ++      NL+ G  +V  +G+ G++
Sbjct: 7   QAQPQGSSSMMLIMMGVMFVGFYFLMIRPQMRKQKQEKNFQENLKVGTRVVLTSGLHGRI 66

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +V DD  +   ++   +++  ++ VS   +++
Sbjct: 67  AQVQDDGFVIETLSG--KLKFEKAAVSREMTEA 97


>gi|238926108|ref|ZP_04657868.1| preprotein translocase subunit YajC [Selenomonas flueggei ATCC
           43531]
 gi|304436596|ref|ZP_07396565.1| preprotein translocase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|238885998|gb|EEQ49636.1| preprotein translocase subunit YajC [Selenomonas flueggei ATCC
           43531]
 gi|304370292|gb|EFM23948.1| preprotein translocase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 93

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               + L   G   +L + +YFLL RPQ+Q  ++R EML  L+ GD+++T  G+ G++  
Sbjct: 3   AEMMAQLSSWGPIVILVLFFYFLLYRPQKQAQKKREEMLSRLKVGDAVITLGGMHGRITA 62

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEV 101
           + D+  + +  AENV +   RS +S V
Sbjct: 63  I-DEKTVTLSAAENVSIVFERSAISGV 88


>gi|94986494|ref|YP_594427.1| preprotein translocase subunit YajC [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94730743|emb|CAJ54105.1| Preprotein translocase subunit YajC [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 112

 Score = 84.4 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 1   MFTTVYAQSDA-PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           M +  +A     P+    ++         ++  ++YFLLIRPQ+++ ++   ML+ L++G
Sbjct: 1   MISIAHAFGTPDPSSGEPSNVFMQFIPLIIMLAIFYFLLIRPQQKRTKQHKAMLQALKKG 60

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
           D I++  G++G++V +  D         +  V++ R++V  + 
Sbjct: 61  DHILSTGGLIGRIVDIDGDTITT--DLGHTTVQINRAYVVGLV 101


>gi|323465934|gb|ADX69621.1| Preprotein translocase subunit YajC [Lactobacillus helveticus H10]
          Length = 144

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A A  +  S + M  LF VL    YF +IRPQ++Q Q+R +M+  L++GD ++   G+  
Sbjct: 10  ASAGAAGGSNMMMIILFIVLIGFTYFGMIRPQKKQQQQRLQMMDKLKKGDGVILVDGLHA 69

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           KV ++  D  + V+ A+ + +   R  V  V     PV
Sbjct: 70  KVDKINSDKTIVVD-ADGIYLTFERMAVRRVIPAVAPV 106


>gi|290967875|ref|ZP_06559425.1| preprotein translocase, YajC subunit [Megasphaera genomosp. type_1
           str. 28L]
 gi|290782014|gb|EFD94592.1| preprotein translocase, YajC subunit [Megasphaera genomosp. type_1
           str. 28L]
          Length = 89

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 52/81 (64%), Gaps = 1/81 (1%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
           +      ++ V++YFLL RPQ++Q +RR EM+ +L+ G  I+TA GI G V    +D  +
Sbjct: 8   QQFWPLIIMIVIFYFLLWRPQKKQQRRRQEMMNSLKVGAKIITAGGIYGVVTATKED-VV 66

Query: 82  EVEIAENVRVRVVRSFVSEVQ 102
           E+ IAE V +++ RS VS+V 
Sbjct: 67  EIRIAEKVEIKISRSAVSQVV 87


>gi|302383727|ref|YP_003819550.1| preprotein translocase subunit YajC [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194355|gb|ADL01927.1| preprotein translocase, YajC subunit [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 100

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 62/88 (70%), Gaps = 1/88 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +     F  + V++YFLLIRPQ+++ +  A ++  ++RGD+IV ++G++GKV RV +
Sbjct: 1   MGLIVQFLPFVAIFVLFYFLLIRPQQKRAKEHAALIAAVKRGDTIVLSSGLIGKVTRV-E 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKS 105
           D E+ VEIA +V VRVV+  ++EV++++
Sbjct: 60  DAEVNVEIAPSVNVRVVKGMIAEVRNRT 87


>gi|294788539|ref|ZP_06753781.1| preprotein translocase, YajC subunit [Simonsiella muelleri ATCC
           29453]
 gi|294483416|gb|EFG31101.1| preprotein translocase, YajC subunit [Simonsiella muelleri ATCC
           29453]
          Length = 112

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 55/100 (55%), Gaps = 4/100 (4%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M    YA +   A       L     F ++ +V +FL+IRPQ+Q  ++R +M+  L++GD
Sbjct: 1   MIELAYADNGTAAAGGG---LMGMIPFVLMLLVMWFLMIRPQQQAEKKRRQMVAELKKGD 57

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
            ++ A+G  G+VV+  +   ++V++ + + V V  + VS 
Sbjct: 58  RVLLASGFYGRVVQAGE-HIVKVDLGKGLVVEVAANAVSA 96


>gi|169831517|ref|YP_001717499.1| preprotein translocase subunit YajC [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638361|gb|ACA59867.1| preprotein translocase, YajC subunit [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 90

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 54/86 (62%), Gaps = 1/86 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            +  +        L  + YFLLIRPQ+ + ++  EM+++L+  D ++T  GI G +V++ 
Sbjct: 1   MSGEMISVLYIIGLFALLYFLLIRPQQVRQKKHMEMIKSLKVNDPVITVGGIYGVIVKLK 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQ 102
           +D  + +++AENV++  +++ +++V+
Sbjct: 61  ED-TVILKVAENVKIEFLKTAIAQVR 85


>gi|332188488|ref|ZP_08390210.1| preprotein translocase, YajC subunit [Sphingomonas sp. S17]
 gi|332011500|gb|EGI53583.1| preprotein translocase, YajC subunit [Sphingomonas sp. S17]
          Length = 116

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 56/82 (68%), Gaps = 1/82 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                   ++ VV+YFL+IRPQ+++++     +  +++GD + TA GIVGKV RV +D  
Sbjct: 27  FLSLAPLLLVFVVFYFLMIRPQQRRMKTLQASIEGVKKGDQVTTAGGIVGKVTRV-EDQL 85

Query: 81  LEVEIAENVRVRVVRSFVSEVQ 102
           +EVEIA NVRVRVV++ +++V 
Sbjct: 86  VEVEIAPNVRVRVVKATLTDVV 107


>gi|257887870|ref|ZP_05667523.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257893331|ref|ZP_05672984.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|257896512|ref|ZP_05676165.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257823924|gb|EEV50856.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257829710|gb|EEV56317.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|257833077|gb|EEV59498.1| conserved hypothetical protein [Enterococcus faecium Com12]
          Length = 121

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +D    
Sbjct: 1   MLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDNDKRTV 59

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
           V   E + +   R+ +  V+ 
Sbjct: 60  VLDCEGIFLEYDRAAIKTVKP 80


>gi|53805143|ref|YP_113193.1| preprotein translocase YajC subunit [Methylococcus capsulatus str.
           Bath]
 gi|53758904|gb|AAU93195.1| preprotein translocase YajC subunit [Methylococcus capsulatus str.
           Bath]
          Length = 118

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                +     VL  V++ L + PQ ++ +   ++L++L +G  +VT  G++G+VV V D
Sbjct: 21  PGAAGLILPMAVL-AVFFLLFVLPQNRRQREHKKLLQSLVKGVEVVTTGGVLGRVVEV-D 78

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + +E+AENV++ V RS V+ +  K  
Sbjct: 79  DNFVTLEVAENVQICVQRSAVASLMPKGT 107


>gi|58617540|ref|YP_196739.1| hypothetical protein ERGA_CDS_08130 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417152|emb|CAI28265.1| Conserved hypothetical protein (may be related to translocase)
           [Ehrlichia ruminantium str. Gardel]
          Length = 126

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI-DDL 79
           +       ++  V+YF +IRPQ+++++   ++L ++++GD ++ +  I G V +V     
Sbjct: 29  IAGLVPLVLIFCVFYFFIIRPQQKKIKEHNKLLESIKKGDKVIISNSIFGVVTKVDATGG 88

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSK 104
              VE++E V ++V++S +SEV  K
Sbjct: 89  HFFVEVSEGVELKVLKSSISEVLDK 113


>gi|332879945|ref|ZP_08447630.1| preprotein translocase, YajC subunit [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332682156|gb|EGJ55068.1| preprotein translocase, YajC subunit [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 98

 Score = 84.0 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L     F ++ VV YFL+IRPQ ++ ++    ++N+++GD ++T  G+ G++V + DD  
Sbjct: 4   LNQLAPFILMFVVLYFLMIRPQMKRQKQEKNFIQNMKKGDKVITKGGVHGRIVELTDDTC 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           +   ++   ++   RS +S   S
Sbjct: 64  VIETLSG--KIMFERSAISMELS 84


>gi|255658293|ref|ZP_05403702.1| preprotein translocase, YajC subunit [Mitsuokella multacida DSM
           20544]
 gi|260849609|gb|EEX69616.1| preprotein translocase, YajC subunit [Mitsuokella multacida DSM
           20544]
          Length = 92

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           +   L   G   V+  ++YFLL RPQ++Q  RR  ML +L++GD ++T  GI G +  + 
Sbjct: 2   SPETLGTLGPIVVMVAIFYFLLYRPQKKQQSRRRAMLDSLKKGDQVITIGGIYGTIEEI- 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            D  L+++IA+ V + VVRS V+   ++ E
Sbjct: 61  GDKSLKLKIADGVVIEVVRSSVNANVTQQE 90


>gi|329122114|ref|ZP_08250722.1| preprotein translocase [Dialister micraerophilus DSM 19965]
 gi|327466921|gb|EGF12437.1| preprotein translocase [Dialister micraerophilus DSM 19965]
          Length = 143

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           T+ +     F ++    YF + RPQ+++   R   L +L++GD I+T  G+ G +++ I 
Sbjct: 8   TAIVTRFWPFVLVLAFIYFFMYRPQKKRQNERDVFLNSLKKGDEIITFGGVYG-IIKSIR 66

Query: 78  DLELEVEIAENVRVRVVRSFVSE 100
           D  +E+EIA  + VRV +  +++
Sbjct: 67  DKYVELEIAHKIVVRVDKQGIAQ 89


>gi|315635821|ref|ZP_07891083.1| preprotein translocase [Arcobacter butzleri JV22]
 gi|315479800|gb|EFU70471.1| preprotein translocase [Arcobacter butzleri JV22]
          Length = 87

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
             +        L  ++YFL+IRPQ++Q +   +M+ NL++GD IVT  G++ +VV+V ++
Sbjct: 3   DLVSSLLPLVALFAIFYFLIIRPQQKQAKAHRDMVANLKKGDKIVTNGGLMVEVVKV-EE 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQ 102
               V+  +   +++++ FV+++ 
Sbjct: 62  TYFLVKNNDGSEMKLIKEFVAKLL 85


>gi|313891691|ref|ZP_07825298.1| preprotein translocase, YajC subunit [Dialister microaerophilus
           UPII 345-E]
 gi|313119969|gb|EFR43154.1| preprotein translocase, YajC subunit [Dialister microaerophilus
           UPII 345-E]
          Length = 140

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           T+ +     F ++    YF + RPQ+++   R   L +L++GD I+T  G+ G +++ I 
Sbjct: 5   TAIVTRFWPFVLVLAFIYFFMYRPQKKRQNERDVFLNSLKKGDEIITFGGVYG-IIKSIR 63

Query: 78  DLELEVEIAENVRVRVVRSFVSE 100
           D  +E+EIA  + VRV +  +++
Sbjct: 64  DKYVELEIAHKIVVRVDKQGIAQ 86


>gi|238855610|ref|ZP_04645911.1| preprotein translocase subunit YajC [Lactobacillus jensenii 269-3]
 gi|260665330|ref|ZP_05866178.1| preprotein translocase subunit [Lactobacillus jensenii SJ-7A-US]
 gi|282933016|ref|ZP_06338410.1| preprotein translocase, YajC subunit [Lactobacillus jensenii 208-1]
 gi|313473095|ref|ZP_07813579.1| preprotein translocase, YajC subunit [Lactobacillus jensenii 1153]
 gi|238831754|gb|EEQ24090.1| preprotein translocase subunit YajC [Lactobacillus jensenii 269-3]
 gi|239528668|gb|EEQ67669.1| preprotein translocase, YajC subunit [Lactobacillus jensenii 1153]
 gi|260560834|gb|EEX26810.1| preprotein translocase subunit [Lactobacillus jensenii SJ-7A-US]
 gi|281302870|gb|EFA95078.1| preprotein translocase, YajC subunit [Lactobacillus jensenii 208-1]
          Length = 124

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  +         +  VL    YF +I+PQ+++ Q+  +ML  L++GD ++  +G+  K+
Sbjct: 7   AAAAGFGSYSTIIMMIVLVGFTYFFMIKPQKKRQQQAMDMLSKLKKGDKVILVSGLHAKI 66

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQ---SKSE 106
             V D  +  V  A+ + +   +  V +V     K E
Sbjct: 67  DSVNDKDKTVVVDADGIFLTFSKMAVRQVVESAPKQE 103


>gi|332974533|gb|EGK11453.1| preprotein translocase [Kingella kingae ATCC 23330]
          Length = 113

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              S L     +  +  V YF++IRPQ+++ + R  M+  L++GD ++  +G  G+VV+ 
Sbjct: 13  QQPSALVSILPWIAIFGVMYFVMIRPQQKREKERQAMISQLKKGDRVLLMSGFYGRVVKA 72

Query: 76  IDDLELEVEIAENVRVRVVRSFVSE 100
            +     +E+++ + V V R+ ++ 
Sbjct: 73  GE-NIFTIELSKGLNVEVERNAIAA 96


>gi|213963587|ref|ZP_03391839.1| preprotein translocase, YajC subunit [Capnocytophaga sputigena
           Capno]
 gi|213953715|gb|EEB65045.1| preprotein translocase, YajC subunit [Capnocytophaga sputigena
           Capno]
          Length = 101

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +  ++ VV YFL+IRPQ ++ ++    ++++++GD ++T  G+ G++V + DD  +  
Sbjct: 9   FLIIALMIVVMYFLMIRPQAKRQKQEKNFIQSMKKGDKVITKGGMHGRIVELTDDTCVIE 68

Query: 84  EIAENVRVRVVRSFVSEVQS 103
            +A   +++  RS +S   S
Sbjct: 69  TLAG--KIKFERSAISMELS 86


>gi|160945178|ref|ZP_02092404.1| hypothetical protein FAEPRAM212_02697 [Faecalibacterium prausnitzii
           M21/2]
 gi|158442909|gb|EDP19914.1| hypothetical protein FAEPRAM212_02697 [Faecalibacterium prausnitzii
           M21/2]
 gi|295105588|emb|CBL03132.1| preprotein translocase, YajC subunit [Faecalibacterium prausnitzii
           SL3/3]
          Length = 105

 Score = 83.6 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 51/88 (57%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
            T++   + +     ++ V+ YF++ RPQ++Q ++ A M  +L  GD + T  G++G+VV
Sbjct: 5   TTTSEGYISLFFTLALMLVLLYFMIYRPQKKQEKKDAAMRSSLEIGDQVTTIGGVIGRVV 64

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEV 101
            + DD  +    A+ V++R  +S +S V
Sbjct: 65  AIKDDTFVLETGADRVKIRFTKSAISSV 92


>gi|297588489|ref|ZP_06947132.1| preprotein translocase [Finegoldia magna ATCC 53516]
 gi|297573862|gb|EFH92583.1| preprotein translocase [Finegoldia magna ATCC 53516]
          Length = 102

 Score = 83.6 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 43/81 (53%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            L        L  V YFL+IRPQ++Q ++  +M   ++ GD ++T  G+ G +V V DD 
Sbjct: 4   MLASLLPLIALFAVMYFLMIRPQQKQQKQLMDMRNAIKVGDEVITIGGVKGTIVSVTDDS 63

Query: 80  ELEVEIAENVRVRVVRSFVSE 100
            +    ++  R+  V++ ++ 
Sbjct: 64  VILETASQKTRLEFVKNAIAS 84


>gi|225025679|ref|ZP_03714871.1| hypothetical protein EIKCOROL_02581 [Eikenella corrodens ATCC
           23834]
 gi|224941572|gb|EEG22781.1| hypothetical protein EIKCOROL_02581 [Eikenella corrodens ATCC
           23834]
          Length = 100

 Score = 83.6 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            A A     S ++       L  + YF+++RP+++  +RR EML  L++GD ++T AG++
Sbjct: 7   AAAAQPDLMSTIQSFLPLIFLFAMLYFMILRPKQRDEKRRREMLSELKKGDKVMTGAGMI 66

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
           GKV ++ ++  + +E+A N  V   R  + +  
Sbjct: 67  GKVSKIGEE-IIGLEVAPNTVVDFHRDAIIKKL 98


>gi|297544497|ref|YP_003676799.1| preprotein translocase subunit YajC [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842272|gb|ADH60788.1| preprotein translocase, YajC subunit [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 99

 Score = 83.6 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 48/82 (58%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                +   ++YFLLI PQ+++ ++  EML +L+ GD I+T +G  GK++ + DD+    
Sbjct: 9   IVQLLIFLAIFYFLLILPQQRRQKKEREMLDSLKPGDEIITKSGFYGKILNIKDDVITLE 68

Query: 84  EIAENVRVRVVRSFVSEVQSKS 105
             A+ VR+++ +  V  V S +
Sbjct: 69  MGADKVRLKIAKWAVGGVISSA 90


>gi|296121603|ref|YP_003629381.1| preprotein translocase, YajC subunit [Planctomyces limnophilus DSM
           3776]
 gi|296013943|gb|ADG67182.1| preprotein translocase, YajC subunit [Planctomyces limnophilus DSM
           3776]
          Length = 123

 Score = 83.6 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                T    M     ++  ++YFL++ PQR++  +R  +++ L++ D +VT  G++G V
Sbjct: 21  GGNPTTEIWGMFVPMIIVVGLFYFLMVVPQRKEQAKRDALIKALKKNDRVVTIGGMIGHV 80

Query: 73  VRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
             +  D  E+ ++  +NVR+   RS + EV  +  P
Sbjct: 81  ANISADGKEITLKFGDNVRIPFRRSAIHEVLGEEVP 116


>gi|260102899|ref|ZP_05753136.1| preprotein translocase [Lactobacillus helveticus DSM 20075]
 gi|260083288|gb|EEW67408.1| preprotein translocase [Lactobacillus helveticus DSM 20075]
          Length = 144

 Score = 83.6 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A A  +  S + M  LF VL    YF +IRPQ++Q Q+R +M+  L++GD +V   G+  
Sbjct: 10  ANAGAAGGSNMMMIILFIVLIGFTYFGMIRPQKKQQQQRLQMMDKLKKGDGVVLVDGLHA 69

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           KV ++  D  + V+ A+ + +   R  V  +     PV
Sbjct: 70  KVDKINSDKTIVVD-ADGIYLTFERMAVRRIIPAVAPV 106


>gi|167629907|ref|YP_001680406.1| preprotein translocase, yajc subunit [Heliobacterium modesticaldum
           Ice1]
 gi|167592647|gb|ABZ84395.1| preprotein translocase, yajc subunit [Heliobacterium modesticaldum
           Ice1]
          Length = 88

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           +      +  ++Y+L IRPQ++  +   EML  LR  + ++TAAGI G +  V +D  + 
Sbjct: 7   LLVYLAAMFGLFYYLFIRPQKKAQKEHKEMLDKLRVHERVLTAAGIYGVITEVGED-TVT 65

Query: 83  VEIAENVRVRVVRSFVSEVQ 102
           V+IAE V+V   ++ +  V 
Sbjct: 66  VKIAEGVQVDFAKTAILRVV 85


>gi|33519696|ref|NP_878528.1| preprotein translocase YajC subunit [Candidatus Blochmannia
           floridanus]
 gi|33517359|emb|CAD83744.1| preprotein translocase YajC subunit [Candidatus Blochmannia
           floridanus]
          Length = 115

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 57/111 (51%), Gaps = 8/111 (7%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +   V+A ++A       SP  +  +  +  +V+YF + RPQ+++ +   E+L ++ +GD
Sbjct: 4   LINKVWANNNA---VDQGSPYSLIIMLIIFIIVFYFTIFRPQQKRSKNHKELLDSIVKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAEN-----VRVRVVRSFVSEVQSKSE 106
            IVT  G+VG+V+RV +   + + + E        V + R  V+ +  K  
Sbjct: 61  EIVTTGGLVGRVLRVTESGYIFIILNEKNNYIHNEVLIKRDCVTAILPKGT 111


>gi|238021375|ref|ZP_04601801.1| hypothetical protein GCWU000324_01274 [Kingella oralis ATCC 51147]
 gi|237868355|gb|EEP69361.1| hypothetical protein GCWU000324_01274 [Kingella oralis ATCC 51147]
          Length = 119

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 53/91 (58%), Gaps = 2/91 (2%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           SP     ++  L  + YF++IRP +++ + R  M+  L++GD ++ AAG  G+V++  + 
Sbjct: 17  SPWSAILMWLPLFAIIYFMMIRPNQKREKARQTMISELKKGDRVLLAAGFYGRVIKTGEH 76

Query: 79  LELEVEIAENVRVRVVRSFVSE-VQSKSEPV 108
           +   +E+A  V + V R+ ++  V + + PV
Sbjct: 77  VF-TIELARGVNIEVDRNAIAAKVDANANPV 106


>gi|89100783|ref|ZP_01173636.1| preprotein translocase subunit YajC [Bacillus sp. NRRL B-14911]
 gi|89084486|gb|EAR63634.1| preprotein translocase subunit YajC [Bacillus sp. NRRL B-14911]
          Length = 82

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 30  LAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENV 89
           + +++YFLLIRPQ+++ +   +M  +L++GD IVT  G+ G +V  ID+ ++ ++  +  
Sbjct: 1   MFILFYFLLIRPQQKRQKSVQQMQSDLKKGDKIVTIGGLHG-IVDAIDEDKIVIKCGDGS 59

Query: 90  RVRVVRSFVSEVQSKSE 106
           R+   R+ + EV++ +E
Sbjct: 60  RLTYDRAAIREVRAAAE 76


>gi|158424519|ref|YP_001525811.1| preprotein translocase subunit [Azorhizobium caulinodans ORS 571]
 gi|158331408|dbj|BAF88893.1| preprotein translocase subunit [Azorhizobium caulinodans ORS 571]
          Length = 114

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 70/107 (65%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF +      A         L     F ++ VV YFL++RPQ+++ +   EM+ +LRRGD
Sbjct: 1   MFISPAFAQGAAPAAGGADMLIQLAPFVLIFVVMYFLILRPQQKKAKAHQEMVNSLRRGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            ++T  G+VGKVV+V+DD E+E++IA+NV+VR +RS ++ V+SK EP
Sbjct: 61  VVITNGGLVGKVVKVVDDAEIEMQIADNVKVRQLRSQIAVVRSKGEP 107


>gi|189425069|ref|YP_001952246.1| preprotein translocase, YajC subunit [Geobacter lovleyi SZ]
 gi|189421328|gb|ACD95726.1| preprotein translocase, YajC subunit [Geobacter lovleyi SZ]
          Length = 107

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 1   MFTTVYAQSDAPAITSATSP---LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLR 57
           M    +A        +                +  ++YFLLIRPQ+++ +    M+  L+
Sbjct: 3   MLGIAFAMGTPAGGAAPQGGAAAFMNFVPLIFMFAIFYFLLIRPQQKKAKEHKAMIDALK 62

Query: 58  RGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            GDS+ TAAGI GK+  + +D  + +EIA  V++++ + FV+ V  
Sbjct: 63  IGDSVKTAAGIHGKIAAL-EDQVVTLEIATGVKIKIDKPFVTTVVK 107


>gi|57167977|ref|ZP_00367116.1| preprotein translocase, YajC subunit [Campylobacter coli RM2228]
 gi|283954659|ref|ZP_06372177.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 414]
 gi|305431872|ref|ZP_07401039.1| preprotein translocase [Campylobacter coli JV20]
 gi|57020351|gb|EAL57020.1| preprotein translocase, YajC subunit [Campylobacter coli RM2228]
 gi|283793851|gb|EFC32602.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 414]
 gi|304444956|gb|EFM37602.1| preprotein translocase [Campylobacter coli JV20]
          Length = 90

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 49/84 (58%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       VL  ++YFL+IRPQ++Q +   +ML +L++GD I+T  G++ +VV+  DD
Sbjct: 5   SILTSLLPLVVLFAIFYFLVIRPQQKQAKAHKQMLESLQKGDKIITNGGLICEVVKPEDD 64

Query: 79  LELEVEIAENVRVRVVRSFVSEVQ 102
                   +NV  ++ R F+++  
Sbjct: 65  FIKVKLNEDNVTAKISREFIAKKI 88


>gi|222824048|ref|YP_002575622.1| conserved hypothetical integral membrane protein, preprotein
           translocase [Campylobacter lari RM2100]
 gi|222539270|gb|ACM64371.1| conserved hypothetical integral membrane protein, putative
           preprotein translocase [Campylobacter lari RM2100]
          Length = 91

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 47/88 (53%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               +         VL  ++YFL+IRPQ++Q +    M+ +L +GD I+T  GI+ +VV+
Sbjct: 2   AENGNIWTSLLPLIVLFAIFYFLVIRPQQKQAKDHKLMVLSLEKGDKIITNGGIICEVVK 61

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQ 102
             +D        ENV V++ R F+++  
Sbjct: 62  PEEDFIKVKLNDENVVVKISRDFIAKKI 89


>gi|42523693|ref|NP_969073.1| preprotein translocase YajC subunit [Bdellovibrio bacteriovorus
           HD100]
 gi|39575900|emb|CAE80066.1| preprotein translocase YajC subunit [Bdellovibrio bacteriovorus
           HD100]
          Length = 117

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/100 (35%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           + +T +AQS AP      S  EM   F  + V++YFL+IRPQ ++ +   + L  ++RGD
Sbjct: 10  LVSTAHAQSAAP--GGQPSAFEMFVPFIFIFVIFYFLIIRPQSKRQKEHQKFLTEIKRGD 67

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
            +VT++GI+G+V  + +   + +EIA+ V+V+++RS ++ 
Sbjct: 68  EVVTSSGILGRVEGITE-QFVTLEIADGVKVKMLRSQIAT 106


>gi|332668064|ref|YP_004450852.1| preprotein translocase subunit YajC [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332336878|gb|AEE53979.1| preprotein translocase, YajC subunit [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 112

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
             A  ++ +          + ++ Y  +IRPQ ++ + +    ++L + D +VT +G++G
Sbjct: 5   QAATGASGAGYINLLFIGAMFLIMYLFMIRPQAKKQREQVAFAKSLTKNDEVVTNSGLLG 64

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++ ++ +D  + +E+   V VRV+R+ +S+  + S
Sbjct: 65  RISKI-EDDIITLEVGTKVYVRVLRNAISKDLTDS 98


>gi|313887232|ref|ZP_07820927.1| preprotein translocase, YajC subunit [Porphyromonas
          asaccharolytica PR426713P-I]
 gi|332299750|ref|YP_004441671.1| preprotein translocase, YajC subunit [Porphyromonas
          asaccharolytica DSM 20707]
 gi|312923323|gb|EFR34137.1| preprotein translocase, YajC subunit [Porphyromonas
          asaccharolytica PR426713P-I]
 gi|332176813|gb|AEE12503.1| preprotein translocase, YajC subunit [Porphyromonas
          asaccharolytica DSM 20707]
          Length = 102

 Score = 83.6 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 1  MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
          MF    AQ  APA             F V+ ++++   IRPQ ++ ++  +    L  GD
Sbjct: 3  MFLLQAAQQGAPA-------WTSLIFFVVIILIFWLFFIRPQSKRQKKLQQERDALAVGD 55

Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
          +++TA G+ G++ +V +    EVEIA +V + + +S V
Sbjct: 56 AVITAGGVHGEIRKVRE-QTFEVEIAHDVCIEIAKSSV 92


>gi|257885771|ref|ZP_05665424.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257821627|gb|EEV48757.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
          Length = 121

 Score = 83.3 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +D    
Sbjct: 1   MLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDNDKRTV 59

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
           V   E + +   R+ +  V+ 
Sbjct: 60  VLDCEGIFLEYDRAAIKTVKP 80


>gi|257878863|ref|ZP_05658516.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257881499|ref|ZP_05661152.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257890721|ref|ZP_05670374.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257813091|gb|EEV41849.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257817157|gb|EEV44485.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257827081|gb|EEV53707.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
          Length = 121

 Score = 83.3 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +D    
Sbjct: 1   MLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDNDKRTV 59

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
           V   E + +   R+ +  V+ 
Sbjct: 60  VLDCEGIFLEYDRAAIKTVKP 80


>gi|157164205|ref|YP_001467051.1| preprotein translocase subunit YajC [Campylobacter concisus 13826]
 gi|112800433|gb|EAT97777.1| preprotein translocase, YajC subunit [Campylobacter concisus 13826]
          Length = 90

 Score = 83.3 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
             L       VL  ++YFL+IRPQ++Q +  A ML  L +GD IVT  G++ +V++  +D
Sbjct: 5   DFLTSLLPLVVLFAIFYFLVIRPQQKQQKAHAAMLAALDKGDKIVTNGGLICEVIKAEND 64

Query: 79  LELEVEIAENVRVRVVRSFVSE 100
             ++V++ ++V VR+ R FV++
Sbjct: 65  F-IKVKLNDDVIVRIAREFVAK 85


>gi|239994272|ref|ZP_04714796.1| preprotein translocase subunit YajC [Alteromonas macleodii ATCC
          27126]
          Length = 98

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 2  FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           +  YAQS           +EM  +  V  +++YFLL RPQ ++++    ++ +L +GD 
Sbjct: 5  ISNAYAQSAGAPQGGG---MEMIIMLAVFGLIFYFLLYRPQAKRVKEHKNLVSSLSKGDE 61

Query: 62 IVTAAGIVGK 71
          ++T  G+VGK
Sbjct: 62 VLTQGGLVGK 71


>gi|313895707|ref|ZP_07829263.1| preprotein translocase, YajC subunit [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312975833|gb|EFR41292.1| preprotein translocase, YajC subunit [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 94

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
              + L   G   +L V +YFLL RPQ+Q  ++R EML  L  G+++VT  G+ G +  +
Sbjct: 4   QMMAQLSSWGPIVILVVFFYFLLYRPQKQAQKKREEMLSRLAAGNAVVTLGGMHGTITAL 63

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSK 104
            D   + +  AE V +   RS +S V S+
Sbjct: 64  -DGKTVTLRAAEGVDIVFERSAISAVVSE 91


>gi|295100845|emb|CBK98390.1| preprotein translocase, YajC subunit [Faecalibacterium prausnitzii
           L2-6]
          Length = 102

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 49/83 (59%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S + +     ++ V+ YF++ RPQ++Q ++ A M  +L  GD + T  G++G+VV + DD
Sbjct: 9   SYISLFFTLALMLVMLYFMIYRPQKKQEKKDAAMRSSLEIGDQVTTIGGVIGRVVAIKDD 68

Query: 79  LELEVEIAENVRVRVVRSFVSEV 101
             +    A+ V++R  ++ +S V
Sbjct: 69  SFVLETGADRVKIRFTKNAISSV 91


>gi|289578216|ref|YP_003476843.1| preprotein translocase, YajC subunit [Thermoanaerobacter italicus
           Ab9]
 gi|289527929|gb|ADD02281.1| preprotein translocase, YajC subunit [Thermoanaerobacter italicus
           Ab9]
          Length = 99

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 46/79 (58%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                +   ++YFLLI PQ+++ ++  EML +L+ GD I+T +G  GK++ + DD+    
Sbjct: 9   IVQLLIFLAIFYFLLILPQQRRQKKEREMLDSLKPGDEIITKSGFYGKILNIKDDVITLE 68

Query: 84  EIAENVRVRVVRSFVSEVQ 102
             A+ VR+++ +  V  V 
Sbjct: 69  MGADKVRLKIAKWAVGGVI 87


>gi|297181290|gb|ADI17482.1| preprotein translocase subunit yajc [uncultured beta
           proteobacterium HF0130_04F21]
          Length = 109

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
            P        ++ VV YFL+IRPQ ++ +    ++  L++ D +VT++GIVGK++ V D 
Sbjct: 15  DPFLSFLPLILMFVVLYFLMIRPQMKRAKEHKILVEGLQKNDEVVTSSGIVGKIINV-DA 73

Query: 79  LELEVEIAEN---VRVRVVRSFVSEVQSKSE 106
             + +EI      +   + R  V  +  K  
Sbjct: 74  SYVTIEIGSGDSKISTLIQRQSVQTLLPKGT 104


>gi|58579486|ref|YP_197698.1| hypothetical protein ERWE_CDS_08220 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418112|emb|CAI27316.1| Conserved hypothetical protein (may be related to translocase)
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 126

 Score = 83.3 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI-DDL 79
           +       ++  V+YF +IRPQ+++++   ++L ++++GD ++ +  I G V +V     
Sbjct: 29  IAGLVPLVLIFCVFYFFIIRPQQKKIKEHNKLLESIKKGDKVIISNSIFGIVTKVDATGG 88

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSK 104
              VE++E V ++V++S +SEV  K
Sbjct: 89  HFFVEVSEGVELKVLKSSISEVLDK 113


>gi|328462819|gb|EGF34686.1| preprotein translocase subunit YajC [Lactobacillus helveticus MTCC
           5463]
          Length = 141

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A A  +  S + M  LF VL    YF +IRPQ++Q Q+R +M+  L++GD +V   G+  
Sbjct: 7   ANAGAAGGSNMMMIILFIVLIGFTYFGMIRPQKKQQQQRLQMMDKLKKGDGVVLVDGLHA 66

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           KV ++  D  + V+ A+ + +   R  V  +     PV
Sbjct: 67  KVDKINSDKTIVVD-ADGIYLTFERMAVRRIIPAVAPV 103


>gi|300114775|ref|YP_003761350.1| preprotein translocase subunit YajC [Nitrosococcus watsonii C-113]
 gi|299540712|gb|ADJ29029.1| preprotein translocase, YajC subunit [Nitrosococcus watsonii C-113]
          Length = 114

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++ +AQ  A     A   +       VL V++YFLLIRPQ+++ +   +++  L++GD 
Sbjct: 9   ISSAWAQEAAGPSPQAG--MFNIIFLVVLLVLFYFLLIRPQQKRAKEHRKLVEGLQKGDE 66

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++   GI+G++  + +   + +EI+ENV ++V R  ++ V  K  
Sbjct: 67  VMIEGGIMGRITELAE-SSMTMEISENVEIKVRRQSIASVLPKGT 110


>gi|57237976|ref|YP_179225.1| preprotein translocase subunit YajC [Campylobacter jejuni RM1221]
 gi|86150390|ref|ZP_01068616.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|86150809|ref|ZP_01069025.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|86153004|ref|ZP_01071209.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|88596034|ref|ZP_01099271.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|121612354|ref|YP_001000772.1| preprotein translocase subunit YajC [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|148926006|ref|ZP_01809692.1| putative membrane protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157415355|ref|YP_001482611.1| preprotein translocase subunit YajC [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|167005688|ref|ZP_02271446.1| preprotein translocase YajC subunit [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|218562708|ref|YP_002344487.1| preprotein translocase subunit YajC [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|283956491|ref|ZP_06373971.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|57166780|gb|AAW35559.1| preprotein translocase, YajC subunit [Campylobacter jejuni RM1221]
 gi|85839215|gb|EAQ56478.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85841979|gb|EAQ59225.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|85843889|gb|EAQ61099.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87249079|gb|EAQ72040.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|88190875|gb|EAQ94847.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360414|emb|CAL35211.1| putative preprotein translocase protein [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|145845485|gb|EDK22577.1| putative membrane protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157386319|gb|ABV52634.1| preprotein translocase YajC subunit [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|283792211|gb|EFC31000.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|284926323|gb|ADC28675.1| preprotein translocase subunit YajC [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|307747996|gb|ADN91266.1| UPF0092 membrane protein [Campylobacter jejuni subsp. jejuni M1]
 gi|315058535|gb|ADT72864.1| Preprotein translocase subunit YajC [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315926736|gb|EFV06113.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           jejuni DFVF1099]
          Length = 90

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 49/84 (58%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       VL  ++YFL+IRPQ++Q +   +ML +L++GD I+T  G++ +VV+  +D
Sbjct: 5   SILTSLLPLVVLFAIFYFLVIRPQQKQAKAHKQMLESLQKGDKIITNGGLICEVVKPEED 64

Query: 79  LELEVEIAENVRVRVVRSFVSEVQ 102
                   +NV  ++ R F+++  
Sbjct: 65  FIKVKLNEDNVTAKISREFIAKKI 88


>gi|325268063|ref|ZP_08134709.1| preprotein translocase [Kingella denitrificans ATCC 33394]
 gi|324980448|gb|EGC16114.1| preprotein translocase [Kingella denitrificans ATCC 33394]
          Length = 109

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
               S       +  +  V YF++IRPQ+++ + R  M+  L++GD ++  +G+ G+VV+
Sbjct: 13  PQQPSGFVAFLPWIAIFAVMYFIMIRPQQKREKERQAMISELKKGDRVLLMSGMYGRVVK 72

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSE 100
              +    VE+A+   V V R+ ++ 
Sbjct: 73  -TGETVFTVELAKGFTVEVERNAIAA 97


>gi|157363174|ref|YP_001469941.1| preprotein translocase, YajC subunit [Thermotoga lettingae TMO]
 gi|157313778|gb|ABV32877.1| preprotein translocase, YajC subunit [Thermotoga lettingae TMO]
          Length = 123

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 55/98 (56%), Gaps = 1/98 (1%)

Query: 5   VYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVT 64
               + +   T+  S      L  +L  ++YFL+I PQR++ ++  EM+ N++RGD+++T
Sbjct: 11  ATGSAPSATTTATGSGWSFIILLAMLFAMFYFLIILPQRRREKQFKEMVSNMKRGDTVIT 70

Query: 65  AAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
             GIVGKV+ +  D  ++++ +    + V +  ++ V 
Sbjct: 71  VGGIVGKVIDIKKD-TIKIKTSMTTELEVTKRAIATVL 107


>gi|282857444|ref|ZP_06266677.1| preprotein translocase, YajC subunit [Pyramidobacter piscolens
           W5455]
 gi|282584729|gb|EFB90064.1| preprotein translocase, YajC subunit [Pyramidobacter piscolens
           W5455]
          Length = 152

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L+      +  V++YF ++RPQ+++ +    ++ +L+RGD ++TA G  G V  V DD  
Sbjct: 39  LQAFFPLIIFVVIFYFFILRPQKKRQRTHDSLVNSLQRGDRVITAGGFFGIVREVKDDS- 97

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           + +EIAE +  RV++S +S   +
Sbjct: 98  VIIEIAEGLVARVLKSSISTKIT 120


>gi|77165814|ref|YP_344339.1| preprotein translocase subunit, YajC [Nitrosococcus oceani ATCC
           19707]
 gi|254434015|ref|ZP_05047523.1| preprotein translocase, YajC subunit [Nitrosococcus oceani AFC27]
 gi|76884128|gb|ABA58809.1| protein translocase subunit yajC [Nitrosococcus oceani ATCC 19707]
 gi|207090348|gb|EDZ67619.1| preprotein translocase, YajC subunit [Nitrosococcus oceani AFC27]
          Length = 111

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            ++ +AQ  A     A   +       VL V++YFLLIRPQ+++ +   +++  L++GD 
Sbjct: 6   ISSAWAQEAAGPSPQAG--MFNIIFLVVLLVLFYFLLIRPQQKRAKEHRKLVEGLQKGDE 63

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++   GI+G++  + +   + +EI+ENV ++V R  ++ V  K  
Sbjct: 64  VMIEGGIMGRITELAE-SSMTMEISENVEIKVRRQSIASVLPKGT 107


>gi|329961414|ref|ZP_08299537.1| preprotein translocase, YajC subunit [Bacteroides fluxus YIT
          12057]
 gi|328531891|gb|EGF58714.1| preprotein translocase, YajC subunit [Bacteroides fluxus YIT
          12057]
          Length = 111

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 23 MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
          M  +   + V+ YF +IRPQ ++ +  A   ++L+    ++TA GI G V++ I+D ++ 
Sbjct: 23 MWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQKVITAGGIHG-VIKEINDNDVV 81

Query: 83 VEIAENVRVRVVRSFV 98
          +EIA NV++R+ ++ +
Sbjct: 82 LEIASNVKIRIDKNSI 97


>gi|313206916|ref|YP_004046093.1| protein translocase subunit yajc [Riemerella anatipestifer DSM
           15868]
 gi|312446232|gb|ADQ82587.1| protein translocase subunit yajC [Riemerella anatipestifer DSM
           15868]
 gi|325335647|gb|ADZ11921.1| YajC [Riemerella anatipestifer RA-GD]
          Length = 110

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 45/88 (51%), Gaps = 2/88 (2%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
              +  S +    +   + V +YF +IRPQ ++ ++      +L+ G  +VT +GI G+V
Sbjct: 8   QAQAQPSIMPTFIMIGGMIVFFYFFMIRPQMKKQKQEKNFQESLKPGRMVVTTSGIHGRV 67

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSE 100
            +V +D  + +E     +++  ++ +S 
Sbjct: 68  SQVTEDG-VILETMAG-KLKFEKAAISR 93


>gi|160892143|ref|ZP_02073146.1| hypothetical protein BACUNI_04606 [Bacteroides uniformis ATCC
          8492]
 gi|317480858|ref|ZP_07939939.1| preprotein translocase subunit [Bacteroides sp. 4_1_36]
 gi|156858621|gb|EDO52052.1| hypothetical protein BACUNI_04606 [Bacteroides uniformis ATCC
          8492]
 gi|316902943|gb|EFV24816.1| preprotein translocase subunit [Bacteroides sp. 4_1_36]
          Length = 111

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 48/77 (62%), Gaps = 1/77 (1%)

Query: 22 EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
           M  +   + V+ YF +IRPQ ++ +  A   ++L+    ++TA GI G V++ I+D ++
Sbjct: 22 MMWIMLIAMFVIMYFFMIRPQNKKQKEIANFRKSLQVNQKVITAGGIHG-VIKEINDNDV 80

Query: 82 EVEIAENVRVRVVRSFV 98
           +EIA NV++R+ ++ +
Sbjct: 81 VLEIASNVKIRIDKNSI 97


>gi|291535348|emb|CBL08460.1| protein translocase subunit yajC [Roseburia intestinalis M50/1]
 gi|291538159|emb|CBL11270.1| protein translocase subunit yajC [Roseburia intestinalis XB6B4]
          Length = 107

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
               M     VL    YF +IRPQ+++ +++  ML  L  GD+++T +G  G V+ + DD
Sbjct: 15  GWGGMIIWLVVLFGFMYFFMIRPQQKEAKKKNAMLSELAVGDTVLTTSGFYGTVIDIADD 74

Query: 79  L-ELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
              +E    +N R+ + ++ +S V+   E +
Sbjct: 75  TVIVEFGNNKNCRIPMQKAAISAVEKPEEAM 105


>gi|255505468|ref|ZP_05346292.3| preprotein translocase, YajC subunit [Bryantella formatexigens DSM
           14469]
 gi|255267804|gb|EET61009.1| preprotein translocase, YajC subunit [Bryantella formatexigens DSM
           14469]
          Length = 119

 Score = 82.9 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 6   YAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTA 65
           +  +++ A +  +S + +     ++    YF+ IRPQ+++ +R   ML  L  GDS+VT 
Sbjct: 17  FLLTESAAASGTSSIIMLVFYVVIIGAAMYFMAIRPQKKEQKRINAMLSELAVGDSVVTT 76

Query: 66  AGIVGKVVRVID-DLELEVEIAENVRVRVVRSFVSEV 101
           +G  G V+ + D D+ +E    +N R+ + +S ++EV
Sbjct: 77  SGFYGVVIDLTDEDVIVEFGSNKNCRIPMRKSAIAEV 113


>gi|326791973|ref|YP_004309794.1| preprotein translocase, YajC subunit [Clostridium lentocellum DSM
           5427]
 gi|326542737|gb|ADZ84596.1| preprotein translocase, YajC subunit [Clostridium lentocellum DSM
           5427]
          Length = 140

 Score = 82.9 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 57/89 (64%), Gaps = 1/89 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             +    + M  ++ V+  V +F+LIRPQ++Q ++  EM  +++ GD+I+  +G+ GKVV
Sbjct: 10  AGAGGGLMSMLLIYAVIIGVMWFILIRPQKKQQKQVEEMQNSVKIGDTILLNSGLYGKVV 69

Query: 74  RVIDDLE-LEVEIAENVRVRVVRSFVSEV 101
            +I+D   +E  + ++VR+ VVRS V+ V
Sbjct: 70  DIINDTFIVEFGLNKSVRIPVVRSTVARV 98


>gi|291277221|ref|YP_003516993.1| protein export-membrane protein YajC [Helicobacter mustelae
          12198]
 gi|290964415|emb|CBG40265.1| protein export-membrane protein, YajC [Helicobacter mustelae
          12198]
          Length = 94

 Score = 82.9 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
            L     F VL +++YF +IRPQR Q ++  +M+  L++GD IVT  G + +V++  ++
Sbjct: 6  GILSSLLPFVVLILIFYFFIIRPQRNQQKKHKQMIEELKKGDKIVTNGGFICEVLK-PEE 64

Query: 79 LELEVEIAENVRVRVVRSFVS 99
              V++ +    RV + F++
Sbjct: 65 GFFSVKLNDETIARVSKDFIA 85


>gi|212702499|ref|ZP_03310627.1| hypothetical protein DESPIG_00516 [Desulfovibrio piger ATCC 29098]
 gi|212674160|gb|EEB34643.1| hypothetical protein DESPIG_00516 [Desulfovibrio piger ATCC 29098]
          Length = 111

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 53/97 (54%), Gaps = 2/97 (2%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
               A  S    L       ++  +++FLLIRPQ+++ +   +ML  L+RGD ++T++G+
Sbjct: 5   QAGGAAPSGGDMLMQFVPLILMFAIFWFLLIRPQQKRAKAHKQMLAELKRGDHVMTSSGL 64

Query: 69  VGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +G+++ + ++  +      + ++R+ R  +  +  KS
Sbjct: 65  IGRIMEISEEEVVI--ECGDAKLRMSRGAIGGLIGKS 99


>gi|257870729|ref|ZP_05650382.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
 gi|257804893|gb|EEV33715.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
          Length = 106

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 36/80 (45%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                V  V  +F + R Q++Q Q R  +L N++ GD +VT  G+ G +  V  D    V
Sbjct: 1   MLFMLVALVAMWFFMSRSQKKQQQERKNLLENMKAGDRVVTIGGLHGVLSEVNTDKSTVV 60

Query: 84  EIAENVRVRVVRSFVSEVQS 103
              E + +   R+ +  V  
Sbjct: 61  IDCEGIFLEFDRAAIRTVTP 80


>gi|227825070|ref|ZP_03989902.1| preprotein translocase subunit yajC [Acidaminococcus sp. D21]
 gi|226905569|gb|EEH91487.1| preprotein translocase subunit yajC [Acidaminococcus sp. D21]
          Length = 127

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 57/85 (67%), Gaps = 1/85 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + ++MA  F ++ V++YF++ RPQ++  ++RA ML +L+ G  IVT  GI G++ ++ DD
Sbjct: 3   NVVQMAWPFILMGVIFYFMIYRPQKRDQKKRANMLDSLKVGTRIVTIGGIFGEIAKIKDD 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQS 103
             + +++AE+V + + R+ V  V +
Sbjct: 63  -RIRIKVAEDVEIWIRRAAVGTVIT 86


>gi|289422382|ref|ZP_06424228.1| preprotein translocase, YajC subunit [Peptostreptococcus anaerobius
           653-L]
 gi|289157217|gb|EFD05836.1| preprotein translocase, YajC subunit [Peptostreptococcus anaerobius
           653-L]
          Length = 106

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                +   G++ ++ V++YFLLIRPQ+++  +  EM  ++ RGD++VT  GI+ KV +V
Sbjct: 2   PQNQMIMGIGIWVLIFVIFYFLLIRPQKKRDNQLKEMRNSIERGDTVVTVGGIIAKVSKV 61

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSK---SEPV 108
            +D  +        +V   +  +  +  K    EP+
Sbjct: 62  DEDKVVLELGPSRTKVPFEKWAIGRIVEKVSNEEPI 97


>gi|163787970|ref|ZP_02182416.1| YajC [Flavobacteriales bacterium ALC-1]
 gi|159876290|gb|EDP70348.1| YajC [Flavobacteriales bacterium ALC-1]
          Length = 97

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 41/86 (47%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
             L     F  +  V YF +I PQ ++ ++  +    L+RGD ++T +G+ GKV  + D 
Sbjct: 3   GGLGTFLPFIAIFAVMYFFMIAPQMKRAKQEKKFASELKRGDRVITKSGMHGKVAELNDK 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSK 104
               V      +++  RS +S   SK
Sbjct: 63  DNSCVVETMAGKIKFDRSAISMEMSK 88


>gi|78043255|ref|YP_360346.1| preprotein translocase subunit YajC [Carboxydothermus
          hydrogenoformans Z-2901]
 gi|77995370|gb|ABB14269.1| preprotein translocase, YajC subunit [Carboxydothermus
          hydrogenoformans Z-2901]
          Length = 92

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 51/79 (64%), Gaps = 1/79 (1%)

Query: 21 LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
          +       V  ++ YF +IRPQ Q+ ++  E L++L+  D ++TA G++G+V+++ +   
Sbjct: 10 VVTIIYLVVFFLIVYFFMIRPQNQRQKQHQEFLKSLKVDDKVLTAGGLIGEVIKIKE-KT 68

Query: 81 LEVEIAENVRVRVVRSFVS 99
          + + +++NV+V +++S ++
Sbjct: 69 VVLRLSDNVKVEILKSAIT 87


>gi|319941719|ref|ZP_08016041.1| preprotein translocase [Sutterella wadsworthensis 3_1_45B]
 gi|319804652|gb|EFW01519.1| preprotein translocase [Sutterella wadsworthensis 3_1_45B]
          Length = 115

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       V+ VV++F LIRPQ+++ +  A+M   L +GD ++T  GI G++  V + 
Sbjct: 22  SFLVQVVPLIVIFVVFWFFLIRPQQKRQKEHAKMCDALAKGDEVMTMGGISGRIESVDEQ 81

Query: 79  L-ELEVEIAEN--VRVRVVRSFVSEVQSKS 105
              L+V   +   V +R+ RS V  V  K 
Sbjct: 82  SMALQVASVDGKPVVIRMQRSAVQMVLPKG 111


>gi|319651689|ref|ZP_08005816.1| preprotein translocase subunit [Bacillus sp. 2_A_57_CT2]
 gi|317396756|gb|EFV77467.1| preprotein translocase subunit [Bacillus sp. 2_A_57_CT2]
          Length = 94

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 30  LAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENV 89
           + V++YFLLIRPQ+++ +   +M  +L++GD +VT  G+ G V  + +D  + ++  +  
Sbjct: 13  MFVLFYFLLIRPQQKRQKAVQQMQSDLKKGDKVVTIGGLHGFVDAIDEDK-VVIKCGDGS 71

Query: 90  RVRVVRSFVSEV 101
           R+   R+ + EV
Sbjct: 72  RLTYDRAAIREV 83


>gi|297569868|ref|YP_003691212.1| preprotein translocase, YajC subunit [Desulfurivibrio
          alkaliphilus AHT2]
 gi|296925783|gb|ADH86593.1| preprotein translocase, YajC subunit [Desulfurivibrio
          alkaliphilus AHT2]
          Length = 109

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 24 AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
               ++ V++YFLLIRPQ+++ +   + L  ++ GD ++T+ GI G +  +  D  + +
Sbjct: 20 FIPLILIFVIFYFLLIRPQQKKAKEHQQFLAAMKIGDEVITSGGIQGTITGLS-DNVVTL 78

Query: 84 EIAENVRVRVVRSFV 98
          EIA+  RV+V R ++
Sbjct: 79 EIADKTRVKVARPYI 93


>gi|257899492|ref|ZP_05679145.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|257837404|gb|EEV62478.1| conserved hypothetical protein [Enterococcus faecium Com15]
          Length = 121

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M  +F  L    +F + R Q++Q Q R  +L +++ GDS+VT  G+ G V  + +D    
Sbjct: 1   MLVMFIALLA-MWFFMSRSQKKQQQERQNLLDSMKPGDSVVTIGGLHGVVSEIDNDKRTV 59

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
           V   E + +   R+ +  V+ 
Sbjct: 60  VIDCEGIFLEYDRAAIKTVKP 80


>gi|167037431|ref|YP_001665009.1| preprotein translocase subunit YajC [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256752585|ref|ZP_05493439.1| preprotein translocase, YajC subunit [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|320115844|ref|YP_004186003.1| preprotein translocase subunit YajC [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166856265|gb|ABY94673.1| preprotein translocase, YajC subunit [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256748523|gb|EEU61573.1| preprotein translocase, YajC subunit [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|319928935|gb|ADV79620.1| preprotein translocase, YajC subunit [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 99

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 48/82 (58%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                +   ++YFLLI PQ+++ ++  EML +L+ GD I+T +G  GK++ + DD+    
Sbjct: 9   IVQMLIFVAIFYFLLILPQQRRQKKEREMLDSLKPGDEIITKSGFYGKILNIKDDVITLE 68

Query: 84  EIAENVRVRVVRSFVSEVQSKS 105
             A+ VR+++ +  V  V S +
Sbjct: 69  MGADKVRLKIAKWAVGGVVSSA 90


>gi|323344946|ref|ZP_08085170.1| preprotein translocase [Prevotella oralis ATCC 33269]
 gi|323094216|gb|EFZ36793.1| preprotein translocase [Prevotella oralis ATCC 33269]
          Length = 107

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 24 AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI-DDLELE 82
            +   + V+ +F +IRPQ+++ +       +L+ G S+VT  GI GKV  +     ++E
Sbjct: 20 LIMIVAMFVIMWFFMIRPQQKKQKEIRNFQNSLQEGSSVVTNGGIYGKVKHIDLSTNKVE 79

Query: 83 VEIAENVRVRVVRSFV 98
          VEIA  V + V ++++
Sbjct: 80 VEIARGVVIEVDKNYI 95


>gi|288799719|ref|ZP_06405178.1| preprotein translocase, YajC subunit [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288332967|gb|EFC71446.1| preprotein translocase, YajC subunit [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 107

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 47/105 (44%), Gaps = 4/105 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
             ++  +   A    +S      +  V+ V+ +F +IRPQ+++ +       +L  G  +
Sbjct: 2   NILFLAAQGAAKGGQSS---FLIMMVVIFVIMWFFMIRPQQKRQKETRNFQNSLAEGTKV 58

Query: 63  VTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +   GI G V  +     +++VE+++ V + V +  V    +  E
Sbjct: 59  IIGGGIYGVVKHIDLTTNKVDVEVSKGVVLTVDKGSVFADLASQE 103


>gi|207091663|ref|ZP_03239450.1| preprotein translocase subunit YajC [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 97

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
             L     F VL +++YFL++RPQRQQ ++  EM+ +L +GD IVT  G++ +V++  + 
Sbjct: 6   DILTTLLPFVVLFLIFYFLIVRPQRQQQKKHKEMIESLTKGDKIVTQGGLIVEVLKA-EA 64

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
               V++ ++   ++ +++++    +  
Sbjct: 65  NFFSVKLNDDTTAKLSKNYIAFKLDEET 92


>gi|307266564|ref|ZP_07548096.1| preprotein translocase, YajC subunit [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306918418|gb|EFN48660.1| preprotein translocase, YajC subunit [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 99

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 48/82 (58%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                +   ++YFLLI PQ+++ ++  EML +L+ GD I+T +G  GK++ + DD+    
Sbjct: 9   IVEMLIFIAIFYFLLILPQQRRQKKEREMLDSLKPGDEIITKSGFYGKILNIKDDVITLE 68

Query: 84  EIAENVRVRVVRSFVSEVQSKS 105
             A+ VR+++ +  V  V S +
Sbjct: 69  MGADKVRLKIAKWAVGGVISSA 90


>gi|326390118|ref|ZP_08211679.1| preprotein translocase, YajC subunit [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325993766|gb|EGD52197.1| preprotein translocase, YajC subunit [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 99

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 48/82 (58%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                +   ++YFLLI PQ+++ ++  EML +L+ GD I+T +G  GK++ + DD+    
Sbjct: 9   IVEMLIFIAIFYFLLILPQQRRQKKEREMLDSLKPGDEIITKSGFYGKILNIKDDVITLE 68

Query: 84  EIAENVRVRVVRSFVSEVQSKS 105
             A+ VR+++ +  V  V S +
Sbjct: 69  MGADKVRLKIAKWAVGGVISSA 90


>gi|256852228|ref|ZP_05557614.1| preprotein translocase subunit [Lactobacillus jensenii 27-2-CHN]
 gi|260661740|ref|ZP_05862651.1| preprotein translocase subunit [Lactobacillus jensenii 115-3-CHN]
 gi|282932644|ref|ZP_06338058.1| preprotein translocase, YajC subunit [Lactobacillus jensenii 208-1]
 gi|297205606|ref|ZP_06923002.1| preprotein translocase [Lactobacillus jensenii JV-V16]
 gi|256615274|gb|EEU20465.1| preprotein translocase subunit [Lactobacillus jensenii 27-2-CHN]
 gi|260547487|gb|EEX23466.1| preprotein translocase subunit [Lactobacillus jensenii 115-3-CHN]
 gi|281303218|gb|EFA95406.1| preprotein translocase, YajC subunit [Lactobacillus jensenii 208-1]
 gi|297150184|gb|EFH30481.1| preprotein translocase [Lactobacillus jensenii JV-V16]
          Length = 124

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 44/90 (48%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  +         +  VL    YF +I+PQ+++ Q+  +ML  L++GD ++  +G+  K+
Sbjct: 7   AAAAGFGSYSTILMMVVLVGFTYFFMIKPQKKRQQQAMDMLSKLKKGDKVILVSGLHAKI 66

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQ 102
             V D  +  V  A+ + +   +  V +V 
Sbjct: 67  DSVNDKNKTVVVDADGIFLTFSKMAVRQVV 96


>gi|308177525|ref|YP_003916931.1| preprotein translocase subunit YajC [Arthrobacter arilaitensis
           Re117]
 gi|307744988|emb|CBT75960.1| preprotein translocase subunit YajC [Arthrobacter arilaitensis
           Re117]
          Length = 136

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 43/93 (46%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  +         L   L  V  F++ R +++Q  ++ ++  N   G  ++T +GI G V
Sbjct: 7   AQAAGGGFNPSLILMVALFAVLIFMMFRGRKKQAAQQEKLKNNTVPGAKVMTNSGIYGTV 66

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           V V  +  ++VE+A  V + + R  ++    K 
Sbjct: 67  VGVDAEDRVQVEVAPGVVLNLHRQAIATFLDKD 99


>gi|295397335|ref|ZP_06807427.1| protein translocase subunit yajC [Aerococcus viridans ATCC 11563]
 gi|294974409|gb|EFG50144.1| protein translocase subunit yajC [Aerococcus viridans ATCC 11563]
          Length = 125

 Score = 82.1 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       VL  + YF+LIRPQ+++ +   EM+  +  GDS VT  G+ G +  + +   
Sbjct: 1   MGTILYIVVLVALMYFMLIRPQQKRQKETQEMMAAMAVGDSAVTIGGLHGVIAEIDETKN 60

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEPV 108
                 E V +   R  V+  Q K++P+
Sbjct: 61  TITLDCEGVYLVFDRRSVARTQ-KADPM 87


>gi|309799097|ref|ZP_07693350.1| preprotein translocase, YajC subunit [Streptococcus infantis
           SK1302]
 gi|308117332|gb|EFO54755.1| preprotein translocase, YajC subunit [Streptococcus infantis
           SK1302]
          Length = 106

 Score = 82.1 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 39/92 (42%), Gaps = 1/92 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
               L    +  ++  +  F + R Q++Q ++R E L  L++G  ++T  G+ G V  V 
Sbjct: 1   MGGNLTFLIMLVLMFGLM-FFMQRSQKKQAEKRMESLNKLQKGYEVITIGGLYGTVDEVD 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            + +  V   + V +      +  V    E V
Sbjct: 60  TENKTIVLDVDGVYLTFELGAIRTVLPVKEAV 91


>gi|90962097|ref|YP_536013.1| protein translocase subunit [Lactobacillus salivarius UCC118]
 gi|227891119|ref|ZP_04008924.1| protein translocase subunit [Lactobacillus salivarius ATCC 11741]
 gi|301301374|ref|ZP_07207516.1| preprotein translocase, YajC subunit [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|90821291|gb|ABD99930.1| Protein translocase subunit [Lactobacillus salivarius UCC118]
 gi|227866993|gb|EEJ74414.1| protein translocase subunit [Lactobacillus salivarius ATCC 11741]
 gi|300851034|gb|EFK78776.1| preprotein translocase, YajC subunit [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 126

 Score = 82.1 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 45/91 (49%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                   +F +L V+ YF +IRPQR+Q Q+  EM+ NL++GD +VT   + G +  +  
Sbjct: 1   MGSTYTIFMFVLLFVMMYFFMIRPQRKQQQQHQEMMNNLKKGDEVVTIGRLHGVIDSINT 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           + +      + V +    + +  V S +  V
Sbjct: 61  EDKTVTLDCDGVYLVFDINAIGRVLSPATTV 91


>gi|332978405|gb|EGK15122.1| preprotein translocase [Psychrobacter sp. 1501(2011)]
          Length = 109

 Score = 82.1 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 44/91 (48%), Gaps = 1/91 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
             T+ +        +  ++YFL+IRPQ ++ +    M+ +L  G+ ++ A G++GK+  +
Sbjct: 16  GGTAMIMQWIFPLAIFAIFYFLVIRPQSKRAKEHRNMVNSLSVGNEVIFAGGLMGKIKSI 75

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             D  + V + +   V + R+ V  V     
Sbjct: 76  EGDYAV-VALNDRNDVMIQRASVISVLPNGT 105


>gi|313114160|ref|ZP_07799712.1| preprotein translocase, YajC subunit [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310623569|gb|EFQ06972.1| preprotein translocase, YajC subunit [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 103

 Score = 82.1 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 51/88 (57%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
            T++   + +     ++ V+ YF++ RPQ++Q ++ A M  +L  GD + T  G++G+VV
Sbjct: 5   TTTSEGYISLFFTLALMLVLLYFMIYRPQKKQEKKDAAMRSSLEIGDQVTTIGGVIGRVV 64

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEV 101
            + DD  +    A+ V++R  ++ +S V
Sbjct: 65  AIKDDTFVLETGADRVKIRFTKTAISAV 92


>gi|260887832|ref|ZP_05899095.1| preprotein translocase, YajC subunit [Selenomonas sputigena ATCC
           35185]
 gi|330838601|ref|YP_004413181.1| preprotein translocase, YajC subunit [Selenomonas sputigena ATCC
           35185]
 gi|260862438|gb|EEX76938.1| preprotein translocase, YajC subunit [Selenomonas sputigena ATCC
           35185]
 gi|329746365|gb|AEB99721.1| preprotein translocase, YajC subunit [Selenomonas sputigena ATCC
           35185]
          Length = 98

 Score = 82.1 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 1/91 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
            +  + L   G    + +V YFL+IRPQR++ +RR EML  LRRG+S+VT  GI G +  
Sbjct: 3   ANMMNALYTYGPLIFMVLVIYFLIIRPQRKEQKRRKEMLDGLRRGNSVVTIGGIYGTLTE 62

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           V  D  ++++IAE+V + V R+ +    +  
Sbjct: 63  VH-DTMVKMKIAEHVEIEVSRASIHANVTDG 92


>gi|71065833|ref|YP_264560.1| protein translocase subunit yajC [Psychrobacter arcticus 273-4]
 gi|71038818|gb|AAZ19126.1| protein translocase subunit yajC [Psychrobacter arcticus 273-4]
          Length = 108

 Score = 82.1 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
           TS L    L      ++YFL+IRPQ ++ +    M+  L  G  I+ A G++G++ + ++
Sbjct: 17  TSLLGQILLPVAFFAIFYFLVIRPQSKRTKEHRAMVSALTVGSEIIFAGGLMGRI-KHLE 75

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
                V +  N  ++V R+ V  V     
Sbjct: 76  GDYAVVSLNNNTDIKVQRASVISVLPAGT 104


>gi|116620400|ref|YP_822556.1| protein translocase subunit yajC [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223562|gb|ABJ82271.1| protein translocase subunit yajC [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 106

 Score = 82.1 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 58/105 (55%), Gaps = 6/105 (5%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M  T++ QS  P      + L       ++  ++YFLL  P ++Q ++ A+ML  L+ GD
Sbjct: 1   MIFTLFLQSAQP------NSLLGFLPILLIFGIFYFLLFLPMQRQKKQTAQMLAELQNGD 54

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           ++VT+ GIVG +V + ++  +     +N++++  RS V+   + +
Sbjct: 55  NVVTSGGIVGTIVALDNETLVLRVKPDNLKLQFARSSVTSKVAST 99


>gi|315023992|gb|EFT36994.1| Preprotein translocase subunit YajC [Riemerella anatipestifer
           RA-YM]
          Length = 110

 Score = 82.1 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 45/88 (51%), Gaps = 2/88 (2%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
              +  S +    +   + V +YF +IRPQ ++ ++      +L+ G  +VT +GI G+V
Sbjct: 8   QAQAQQSIMPTFIMIGGMIVFFYFFMIRPQMKKQKQEKNFQESLKPGRMVVTTSGIHGRV 67

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSE 100
            +V +D  + +E     +++  ++ +S 
Sbjct: 68  SQVTEDG-VILETMAG-KLKFEKAAISR 93


>gi|257876336|ref|ZP_05655989.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
 gi|257810502|gb|EEV39322.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
          Length = 107

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 37/80 (46%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                V  V  +F + R Q++Q Q R  +L N++ GD +VT  G+ G +  V  +    +
Sbjct: 1   MLFMLVALVAMWFFMSRSQKKQQQERKNLLENMKAGDEVVTIGGLHGVLSEVNTEKSTVI 60

Query: 84  EIAENVRVRVVRSFVSEVQS 103
              E + +   RS +  V+ 
Sbjct: 61  IDCEGIFLEFDRSAIRTVKP 80


>gi|291548222|emb|CBL21330.1| protein translocase subunit yajC [Ruminococcus sp. SR1/5]
          Length = 104

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           + + A     S         VL  + YF++IRPQ+++ +R   ML ++  GDS+VT +G 
Sbjct: 3   ASSTAAAGGLSAGLGIVWIVVLFGIMYFMMIRPQKKEQKRTQTMLNSMEVGDSVVTTSGF 62

Query: 69  VGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEV 101
            G V+ +  +D+ +E    +N R+ + +  ++EV
Sbjct: 63  YGVVIDMTEEDVIVEFGNNKNCRIPMRKQAIAEV 96


>gi|167040098|ref|YP_001663083.1| preprotein translocase subunit YajC [Thermoanaerobacter sp. X514]
 gi|300914181|ref|ZP_07131497.1| preprotein translocase, YajC subunit [Thermoanaerobacter sp. X561]
 gi|307724583|ref|YP_003904334.1| preprotein translocase subunit YajC [Thermoanaerobacter sp. X513]
 gi|166854338|gb|ABY92747.1| preprotein translocase, YajC subunit [Thermoanaerobacter sp. X514]
 gi|300889116|gb|EFK84262.1| preprotein translocase, YajC subunit [Thermoanaerobacter sp. X561]
 gi|307581644|gb|ADN55043.1| preprotein translocase, YajC subunit [Thermoanaerobacter sp. X513]
          Length = 99

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 47/82 (57%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                +   ++YFLLI PQ+++ ++  EML +L+ GD I+T  G  GK++ + DD+    
Sbjct: 9   IVQMLIFVAIFYFLLILPQQRRQKKEREMLDSLKPGDEIITKNGFYGKILNIKDDVITLE 68

Query: 84  EIAENVRVRVVRSFVSEVQSKS 105
             A+ VR+++ +  V  V S +
Sbjct: 69  MGADKVRLKIAKWAVGGVVSSA 90


>gi|114320372|ref|YP_742055.1| protein translocase subunit yajC [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226766|gb|ABI56565.1| protein translocase subunit yajC [Alkalilimnicola ehrlichii MLHE-1]
          Length = 112

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
            +   AQ            L       VL  V++FL+IRPQ+++++   EML  L+  D 
Sbjct: 5   ISPAMAQG----GADGGGGLSFLVFTLVLIAVFWFLVIRPQQKRVKAHREMLSELKVDDE 60

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G +G++   ++D  + +++       V R  V+    +  
Sbjct: 61  VVTNGGDLGRI-NWLNDNWVGLQVTPEQEWVVQRQLVAHQMPRGT 104


>gi|325954220|ref|YP_004237880.1| preprotein translocase, YajC subunit [Weeksella virosa DSM 16922]
 gi|323436838|gb|ADX67302.1| preprotein translocase, YajC subunit [Weeksella virosa DSM 16922]
          Length = 105

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M ++++ Q+ A              LF  + ++ YF +IRP  Q+ ++       ++ GD
Sbjct: 1   MTSSIFLQAGA-----EGGGWGTLLLFGGMFIIMYFFMIRPTMQRQKKEKLFQDEVKVGD 55

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            +VT +GI G++ ++ DD  + +E     ++++ R+ +S+  +
Sbjct: 56  QVVTTSGIHGRIGQLSDDHFI-LETGAG-KIKMERTAISKELT 96


>gi|255656785|ref|ZP_05402194.1| putative protein translocase subunit [Clostridium difficile
           QCD-23m63]
 gi|296452386|ref|ZP_06894087.1| preprotein translocase [Clostridium difficile NAP08]
 gi|296877734|ref|ZP_06901761.1| preprotein translocase [Clostridium difficile NAP07]
 gi|296258716|gb|EFH05610.1| preprotein translocase [Clostridium difficile NAP08]
 gi|296431267|gb|EFH17087.1| preprotein translocase [Clostridium difficile NAP07]
          Length = 97

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 50/93 (53%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                +   GL+ V+  ++YFL+IRPQ+++ ++  EM  +L  GD +VT  GIV  V +V
Sbjct: 2   PQQQIIMSIGLWVVVIAIFYFLMIRPQKKKDKQLKEMRSSLGVGDKVVTIGGIVANVAKV 61

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            DD+ +        +V   +  +  V+SK E +
Sbjct: 62  EDDVVILELGPNRTKVPFEKWAIGTVKSKKEEI 94


>gi|307566378|ref|ZP_07628817.1| preprotein translocase, YajC subunit [Prevotella amnii CRIS
          21A-A]
 gi|307344955|gb|EFN90353.1| preprotein translocase, YajC subunit [Prevotella amnii CRIS
          21A-A]
          Length = 107

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 14 ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
            S      M  +   + V+ YF +IRPQ+++ ++       L+ GDS+VT  GI G V 
Sbjct: 9  AQSQGGGYSMIIMMVAIFVIMYFFMIRPQQKKQKQIRAFQNALKDGDSVVTGGGIYGIVK 68

Query: 74 RVI-DDLELEVEIAENVRVRVVRSFV 98
          R+     ++++EI++ V + V +S+V
Sbjct: 69 RIDLTTGKIDIEISKGVVITVDKSYV 94


>gi|259501309|ref|ZP_05744211.1| preprotein translocase [Lactobacillus iners DSM 13335]
 gi|259167279|gb|EEW51774.1| preprotein translocase [Lactobacillus iners DSM 13335]
          Length = 105

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            L    +  ++    YF +IRPQ++Q Q R +ML  L++GD ++   G+  K+  +  D 
Sbjct: 1   MLVTIFMVVIMFGFMYFAMIRPQKKQQQVRMKMLSELKKGDKVILLDGMHCKIDTINGDD 60

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKS 105
            + V+ A+ + +   RS + ++    
Sbjct: 61  TIVVD-ADGIFLTFSRSAIRQILPDD 85


>gi|212550521|ref|YP_002308838.1| preprotein translocase YajC subunit [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
 gi|212548759|dbj|BAG83427.1| preprotein translocase YajC subunit [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
          Length = 112

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
            TS  S      +  ++ ++ YF +IRPQ++Q +R  E   +L+ GD +V + GI GK+
Sbjct: 9  QATSVGSSYSGLIMIVLIFIIMYFFMIRPQQKQRKRVEEQRASLKEGDKVVISGGIHGKL 68

Query: 73 VRVIDDLELEVEIAENVRVRVVRSFV 98
           +V +D    +EIAE V+V V +  V
Sbjct: 69 KKV-NDTSCIIEIAEMVKVEVDKLSV 93


>gi|332653322|ref|ZP_08419067.1| preprotein translocase, YajC subunit [Ruminococcaceae bacterium
           D16]
 gi|332518468|gb|EGJ48071.1| preprotein translocase, YajC subunit [Ruminococcaceae bacterium
           D16]
          Length = 102

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 38/86 (44%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                      +  ++  + YF +IRP+ ++ +    +  +L  GD I T  G+ G V  
Sbjct: 7   GGNNMDYSWIVMLVLMFALLYFFMIRPENKRKKEAENLRNSLAVGDEITTIGGMTGTVCA 66

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSE 100
           V ++  +    A+ VR+ + +  VS 
Sbjct: 67  VKENTIVFETGADRVRIEITKWAVST 92


>gi|325567159|ref|ZP_08143826.1| preprotein translocase [Enterococcus casseliflavus ATCC 12755]
 gi|325158592|gb|EGC70738.1| preprotein translocase [Enterococcus casseliflavus ATCC 12755]
          Length = 113

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 37/81 (45%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
                 V  V  +F + R Q++Q Q R  +L N++ GD +VT  G+ G +  V  +    
Sbjct: 6   PMLFMLVALVAMWFFMSRSQKKQQQERKNLLENMKAGDEVVTIGGLHGVLSEVNTEKSTV 65

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
           +   E + +   RS +  V+ 
Sbjct: 66  IIDCEGIFLEFDRSAIRTVKP 86


>gi|297584753|ref|YP_003700533.1| preprotein translocase subunit YajC [Bacillus selenitireducens
           MLS10]
 gi|297143210|gb|ADH99967.1| preprotein translocase, YajC subunit [Bacillus selenitireducens
           MLS10]
          Length = 93

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 30  LAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENV 89
           +  ++YFLLIRPQ+++ ++  EM + L++GD ++T  G+ GK+  + +D  + V++  + 
Sbjct: 19  MFAIFYFLLIRPQQKRQKKIQEMHQALQKGDRVITIGGMHGKIDAIDEDK-IVVDVNGSQ 77

Query: 90  RVRVVRSFVSEVQS 103
           ++   R  V EV +
Sbjct: 78  KLTFDRQAVREVVN 91


>gi|327439544|dbj|BAK15909.1| preprotein translocase subunit YajC [Solibacillus silvestris
           StLB046]
          Length = 86

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       V+ V  +F+LIRP +++ +  A M  +L+RGD +VT  G+ G+V  + +
Sbjct: 1   MEGLVQFLPIIVMFVAMWFILIRPAQKRQKATATMQNSLKRGDKVVTVGGLHGEVDAI-E 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEV 101
           D  + + +  N R++  R  +  V
Sbjct: 60  DTTVYLIVDGNTRLKFERQAIGRV 83


>gi|257866744|ref|ZP_05646397.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257872739|ref|ZP_05652392.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
 gi|257800702|gb|EEV29730.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257806903|gb|EEV35725.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
          Length = 106

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 37/80 (46%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
                V  V  +F + R Q++Q Q R  +L N++ GD +VT  G+ G +  V  +    +
Sbjct: 1   MLFMLVALVAMWFFMSRSQKKQQQERKNLLENMKAGDEVVTIGGLHGVLSEVNTEKSTVI 60

Query: 84  EIAENVRVRVVRSFVSEVQS 103
              E + +   RS +  V+ 
Sbjct: 61  IDCEGIFLEFDRSAIRTVKP 80


>gi|261840233|gb|ACX99998.1| preprotein translocase subunit YajC [Helicobacter pylori 52]
          Length = 97

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 15 TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                L     F VL +++YFL++RPQRQQ ++  EM+ +L +GD +VT  G++ +V++
Sbjct: 2  GQTKEILTTLLPFVVLFLIFYFLIVRPQRQQQKKHKEMIESLTKGDKVVTQGGLIVEVLK 61

Query: 75 VIDDLELEVEIAENVRVRVVRSFVS 99
            +     V++ ++   ++ +++++
Sbjct: 62 A-EANFFSVKLNDDTTAKLSKNYIA 85


>gi|256425203|ref|YP_003125856.1| preprotein translocase, YajC subunit [Chitinophaga pinensis DSM
           2588]
 gi|256040111|gb|ACU63655.1| preprotein translocase, YajC subunit [Chitinophaga pinensis DSM
           2588]
          Length = 117

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 44/75 (58%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
                + +V +  +IRPQ ++ + + + + NLR GD IVT AGI GKV ++ D+  L++E
Sbjct: 27  IFIGGMILVMWLFMIRPQTKKAKLQKDFISNLREGDKIVTIAGIHGKVKKINDNNTLQIE 86

Query: 85  IAENVRVRVVRSFVS 99
           ++      V RS +S
Sbjct: 87  VSPGTYFTVERSAIS 101


>gi|153952484|ref|YP_001397793.1| preprotein translocase subunit YajC [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939930|gb|ABS44671.1| preprotein translocase, YajC subunit [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 90

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 48/82 (58%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       VL  ++YFL+IRPQ++Q +   +ML +L++GD I+T  G++ +VV+  +D
Sbjct: 5   SILTSLLPLVVLFAIFYFLVIRPQQKQAKAHKQMLESLQKGDKIITNGGLICEVVKPEED 64

Query: 79  LELEVEIAENVRVRVVRSFVSE 100
                   +N   ++ R F+++
Sbjct: 65  FIKVKLNEDNATAKISREFIAK 86


>gi|242309302|ref|ZP_04808457.1| preprotein translocase subunit YajC [Helicobacter pullorum MIT
           98-5489]
 gi|239524343|gb|EEQ64209.1| preprotein translocase subunit YajC [Helicobacter pullorum MIT
           98-5489]
          Length = 89

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           A +         VL  ++YFL+IRPQ++Q +   EM+ +L +GD IVT+ G + +VV+  
Sbjct: 4   AGNIFTQLLPLIVLIAIFYFLIIRPQQKQAKNHREMIASLDKGDKIVTSGGFIVEVVK-R 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSE 100
           ++    V + ++  V++ + +V++
Sbjct: 63  EEDYFMVRLNDDTIVKLAKDYVAK 86


>gi|313904140|ref|ZP_07837519.1| preprotein translocase, YajC subunit [Eubacterium cellulosolvens 6]
 gi|313470942|gb|EFR66265.1| preprotein translocase, YajC subunit [Eubacterium cellulosolvens 6]
          Length = 116

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A A   A S   M  +   + V+ YF++IRPQ+++ +R  EML ++  GD++VT +G  G
Sbjct: 4   ASANAGAGSMASMLIMIVAMFVLMYFMMIRPQKKEQKRMQEMLTSMEIGDAVVTTSGFYG 63

Query: 71  KVVRVIDDL-ELEVEIAENVRVRVVRSFVSEV 101
            ++ + DD   +E    +N R+ + +  +++V
Sbjct: 64  ILIDISDDDVIVEFGNNKNCRIPMRKEAITQV 95


>gi|126700417|ref|YP_001089314.1| putative protein translocase subunit [Clostridium difficile 630]
 gi|254976396|ref|ZP_05272868.1| putative protein translocase subunit [Clostridium difficile
           QCD-66c26]
 gi|255093782|ref|ZP_05323260.1| putative protein translocase subunit [Clostridium difficile CIP
           107932]
 gi|255101972|ref|ZP_05330949.1| putative protein translocase subunit [Clostridium difficile
           QCD-63q42]
 gi|255307840|ref|ZP_05352011.1| putative protein translocase subunit [Clostridium difficile ATCC
           43255]
 gi|255315533|ref|ZP_05357116.1| putative protein translocase subunit [Clostridium difficile
           QCD-76w55]
 gi|255518196|ref|ZP_05385872.1| putative protein translocase subunit [Clostridium difficile
           QCD-97b34]
 gi|255651312|ref|ZP_05398214.1| putative protein translocase subunit [Clostridium difficile
           QCD-37x79]
 gi|260684376|ref|YP_003215661.1| putative protein translocase subunit [Clostridium difficile CD196]
 gi|260688035|ref|YP_003219169.1| putative protein translocase subunit [Clostridium difficile R20291]
 gi|306521144|ref|ZP_07407491.1| putative protein translocase subunit [Clostridium difficile
           QCD-32g58]
 gi|115251854|emb|CAJ69689.1| conserved hypothetical protein [Clostridium difficile]
 gi|260210539|emb|CBA65066.1| putative protein translocase subunit [Clostridium difficile CD196]
 gi|260214052|emb|CBE06213.1| putative protein translocase subunit [Clostridium difficile R20291]
          Length = 97

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 50/93 (53%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                +   GL+ V+  ++YFL+IRPQ+++ ++  EM  +L  GD ++T  GIV  V +V
Sbjct: 2   PQQQIIMSIGLWVVVIAIFYFLMIRPQKKKDKQLKEMRSSLSVGDKVITIGGIVANVAKV 61

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            DD+ +        +V   +  +  V+SK E +
Sbjct: 62  EDDVVILELGPNRTKVPFEKWAIGTVKSKKEEI 94


>gi|89895208|ref|YP_518695.1| hypothetical protein DSY2462 [Desulfitobacterium hafniense Y51]
 gi|219669639|ref|YP_002460074.1| preprotein translocase, YajC subunit [Desulfitobacterium hafniense
           DCB-2]
 gi|89334656|dbj|BAE84251.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539899|gb|ACL21638.1| preprotein translocase, YajC subunit [Desulfitobacterium hafniense
           DCB-2]
          Length = 118

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
             + +     V   + YF +IRPQ++Q ++R  ML +LR  D I+TA GI GK+ +V +D
Sbjct: 4   GTMTLLIYVVVFGGIMYFFMIRPQQKQAKQRRAMLDSLRVNDKIITAGGIYGKIRKVKED 63

Query: 79  LELEVEIAENVRVRVVRSFVSEV 101
             + ++IA+ V + V ++ V  V
Sbjct: 64  S-VIIQIADKVEIEVTKTGVGSV 85


>gi|317470629|ref|ZP_07930015.1| preprotein translocase [Anaerostipes sp. 3_2_56FAA]
 gi|316901920|gb|EFV23848.1| preprotein translocase [Anaerostipes sp. 3_2_56FAA]
          Length = 97

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S   M     ++    YFLLIRPQ+++ Q+  E+  +L  GDS++T +G  G VV  +DD
Sbjct: 3   SQFSMILWLIIVFGGMYFLLIRPQKKKDQQMKELAASLEVGDSVLTISGFYGVVVDAVDD 62

Query: 79  LELEVEIAEN--VRVRVVRSFVSEV 101
             + VE   +   R+ + R+ +S+V
Sbjct: 63  KTIVVEFGNDKHCRIPMERAAISQV 87


>gi|169331619|ref|ZP_02860812.1| hypothetical protein ANASTE_00003 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259681|gb|EDS73647.1| hypothetical protein ANASTE_00003 [Anaerofustis stercorihominis DSM
           17244]
          Length = 94

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
               + M G+  VL  + YF+ IRPQ+++ +    +L  L+ GD ++TA G +G VV V 
Sbjct: 2   GQDFIVMIGIIVVLFGITYFMTIRPQQKRFKEHQNLLNELKNGDEVMTAGGFIGTVVSVD 61

Query: 77  DDLELEVEIAENVRVRVVRSFVSE 100
           +D  +     + +  ++ R  +  
Sbjct: 62  EDTAVIALEPDGINAKINRQSIVS 85


>gi|94676714|ref|YP_589025.1| preprotein translocase subunit YajC [Baumannia cicadellinicola str.
           Hc (Homalodisca coagulata)]
 gi|94219864|gb|ABF14023.1| Preprotein translocase YajC [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 110

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 53/106 (50%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M + +     + + +   S   M  +     + +YF+++RPQ+++ +    ++ ++ +GD
Sbjct: 1   MLSIISDAIASTSTSYQGSSYSMIIMLLFFGLFFYFIILRPQQKRAKLHKALIHSITKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            I+T  G+VGKV +V +     V + +   V + R F++ +  K  
Sbjct: 61  EILTNGGLVGKVAKVTETGYFLVSLNDTNEVLIKRDFITAILPKGT 106


>gi|93005937|ref|YP_580374.1| preprotein translocase, YajC subunit [Psychrobacter cryohalolentis
           K5]
 gi|92393615|gb|ABE74890.1| protein translocase subunit yajC [Psychrobacter cryohalolentis K5]
          Length = 108

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S      L      ++YFL+IRPQ ++ +    M+  L  G  I+ A G++G++ + ++ 
Sbjct: 18  SLFGQILLPVAFFAIFYFLVIRPQSKRTKEHRAMVSALTVGSEIIFAGGLMGRI-KHLEG 76

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
               V +  N  ++V R+ V  V     
Sbjct: 77  DYAVVSLNNNTDIKVQRASVISVLPAGT 104


>gi|310829215|ref|YP_003961572.1| preprotein translocase [Eubacterium limosum KIST612]
 gi|308740949|gb|ADO38609.1| preprotein translocase [Eubacterium limosum KIST612]
          Length = 147

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 44/86 (51%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + L       +L V +YF ++RPQ +Q +    M  N++ GD I+T  G  G +  + D+
Sbjct: 3   NGLVTFLPLILLVVFFYFFIMRPQNKQKKEIQAMRDNMKPGDEILTIGGFYGIIYAIDDE 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSK 104
             +   + +  +  +V+S VS+V  +
Sbjct: 63  NIVLEMLPDFHKAMIVKSAVSKVIKR 88


>gi|300871146|ref|YP_003786018.1| preprotein translocase subunit YajC [Brachyspira pilosicoli
           95/1000]
 gi|300688846|gb|ADK31517.1| preprotein translocase, YajC subunit [Brachyspira pilosicoli
           95/1000]
          Length = 141

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 66/106 (62%), Gaps = 3/106 (2%)

Query: 1   MFT-TVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MFT T+YAQ+   A     SPL   G+   +  ++YFLLIRPQ++Q Q+ A+ + +L++G
Sbjct: 1   MFTATLYAQTTGGAQAGG-SPLVSIGMMVAIFAIFYFLLIRPQKKQQQKLAQSIASLKKG 59

Query: 60  DSIVTAAGIVGKVVRVIDDLEL-EVEIAENVRVRVVRSFVSEVQSK 104
           D I+ A GIV + V   +   +  V++ EN ++ +++S +S V S+
Sbjct: 60  DKIIVAGGIVAEYVSDKEGGRVAIVKLGENTKIEIIKSSISAVVSE 105


>gi|134299524|ref|YP_001113020.1| preprotein translocase subunit YajC [Desulfotomaculum reducens
           MI-1]
 gi|134052224|gb|ABO50195.1| protein translocase subunit yajC [Desulfotomaculum reducens MI-1]
          Length = 93

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
                  L  + YFL+IRPQ+++ ++ A M++ L  GD+IVT  G++G V+++ +   + 
Sbjct: 9   SIIYIVALFAILYFLMIRPQQKRQKQHAAMIKALNVGDNIVTVGGLLGSVIKIKE-TTVV 67

Query: 83  VEIAENVRVRVVRSFVSEVQSK 104
           V +A+ V + ++++ +++V  K
Sbjct: 68  VRVADKVNIEILKNAIAQVTEK 89


>gi|217033848|ref|ZP_03439273.1| hypothetical protein HP9810_877g52 [Helicobacter pylori 98-10]
 gi|216943746|gb|EEC23189.1| hypothetical protein HP9810_877g52 [Helicobacter pylori 98-10]
          Length = 97

 Score = 81.3 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 15 TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                L     F VL +++YFL++RPQRQQ ++  EM+  L RGD +VT  G++ +V++
Sbjct: 2  GQTKDILTTLLPFLVLFLIFYFLIVRPQRQQQKKHKEMIEGLTRGDKVVTQGGLIVEVLK 61

Query: 75 VIDDLELEVEIAENVRVRVVRSFVS 99
            +     V++ ++   ++ +++++
Sbjct: 62 A-EANFFSVKLNDDTTAKLSKNYIA 85


>gi|317495472|ref|ZP_07953840.1| preprotein translocase subunit protein [Gemella moribillum M424]
 gi|316914286|gb|EFV35764.1| preprotein translocase subunit protein [Gemella moribillum M424]
          Length = 87

 Score = 81.3 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
                  +   L    YF++IRPQ ++ +    +  +L+ GD IVT AGI G+++ V   
Sbjct: 3   GSYINILMIVFLFGFMYFMIIRPQSKRNKELKLLQDSLKEGDRIVTFAGIYGEIIEV-GT 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSK 104
           L +++ IA  V + + R+ +  + SK
Sbjct: 62  LTVKLRIAPKVEIELDRNAIRSLVSK 87


>gi|225010644|ref|ZP_03701114.1| preprotein translocase, YajC subunit [Flavobacteria bacterium
           MS024-3C]
 gi|225005197|gb|EEG43149.1| preprotein translocase, YajC subunit [Flavobacteria bacterium
           MS024-3C]
          Length = 94

 Score = 81.3 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 41/84 (48%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L       ++ VV YF +IRPQ ++ +   +    L +GD ++T +G+ GKVV + +   
Sbjct: 4   LNQFLPLALIVVVGYFFMIRPQMKRQKDEKKFSAALAKGDRVITKSGMHGKVVELNEKDA 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSK 104
             V      +++   S +S   SK
Sbjct: 64  SCVIETMAGKIKFDLSAISMELSK 87


>gi|322388367|ref|ZP_08061970.1| preprotein translocase [Streptococcus infantis ATCC 700779]
 gi|321140680|gb|EFX36182.1| preprotein translocase [Streptococcus infantis ATCC 700779]
          Length = 109

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 37/88 (42%), Gaps = 1/88 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +   +  +  F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  +  
Sbjct: 8   LTFLIMLVGMFALM-FFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTENR 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEPV 108
             V   + V +      +  V    E V
Sbjct: 67  TIVLDVDGVYLTFELGAIKSVLPLKEAV 94


>gi|323143764|ref|ZP_08078432.1| preprotein translocase, YajC subunit [Succinatimonas hippei YIT
           12066]
 gi|322416477|gb|EFY07143.1| preprotein translocase, YajC subunit [Succinatimonas hippei YIT
           12066]
          Length = 116

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 47/90 (52%), Gaps = 1/90 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              + M  +  +  +  YF ++RP  ++ +   ++L  L  GD ++T  GI G++ ++ +
Sbjct: 18  GGDMSMMIVLVMCMLAVYFFVMRPNSKKRKEMQKLLDGLSVGDEVLTNGGIAGRISKLPE 77

Query: 78  DL-ELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +   + + +A+ + +++ R+++  V  K  
Sbjct: 78  NKEYVLISVADGIVIQMKRNYIVAVLPKGT 107


>gi|152976834|ref|YP_001376351.1| preprotein translocase subunit YajC [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152025586|gb|ABS23356.1| preprotein translocase, YajC subunit [Bacillus cytotoxicus NVH
           391-98]
          Length = 86

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 2/88 (2%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
            +  +    +   +  ++YFLLIRPQ+++ +  A+M   L++GD+IVT  G+ G +  V 
Sbjct: 1   MSPGMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELKKGDAIVTIGGLHGTIESV- 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSK 104
           DD  + ++ +    +   R+ V EV  K
Sbjct: 60  DDTTIVIK-SGGSHLTFDRNAVREVVKK 86


>gi|270308548|ref|YP_003330606.1| preprotein translocase subunit [Dehalococcoides sp. VS]
 gi|270154440|gb|ACZ62278.1| preprotein translocase subunit [Dehalococcoides sp. VS]
          Length = 92

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 21 LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
          + M  L  +   ++YFL+IRPQRQ+ +  A ++ +L +GD ++T  GI G +  V +D  
Sbjct: 6  ITMFVLLALFFGMFYFLIIRPQRQRQKDHANLMSSLVKGDGVITIGGIHGVIESVAEDS- 64

Query: 81 LEVEIAENVRVRVVRSFV 98
          + +++     +RV R  +
Sbjct: 65 VIIKVESGTLLRVSRGAI 82


>gi|307244268|ref|ZP_07526383.1| preprotein translocase, YajC subunit [Peptostreptococcus stomatis
           DSM 17678]
 gi|306492418|gb|EFM64456.1| preprotein translocase, YajC subunit [Peptostreptococcus stomatis
           DSM 17678]
          Length = 106

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 50/90 (55%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
                +   G++ ++ V++YF+LIRPQ+Q+ ++  EM  ++ +GD+++T  GI+ KV RV
Sbjct: 2   PQNQMIMGIGIWILIFVIFYFILIRPQKQKEKKLNEMRNSIDKGDTVITVGGIIAKVTRV 61

Query: 76  IDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +D  +        +V   +  +  V  K+
Sbjct: 62  EEDRIILELGPNRTKVPFEKWAIGRVIEKA 91


>gi|15594996|ref|NP_212785.1| hypothetical protein BB0651 [Borrelia burgdorferi B31]
 gi|195941471|ref|ZP_03086853.1| hypothetical protein Bbur8_01131 [Borrelia burgdorferi 80a]
 gi|221217904|ref|ZP_03589371.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 72a]
 gi|223889411|ref|ZP_03623997.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 64b]
 gi|224532966|ref|ZP_03673574.1| preprotein translocase, YajC subunit [Borrelia burgdorferi WI91-23]
 gi|224533325|ref|ZP_03673919.1| preprotein translocase, YajC subunit [Borrelia burgdorferi
           CA-11.2a]
 gi|225548984|ref|ZP_03769961.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 94a]
 gi|226320350|ref|ZP_03795919.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 29805]
 gi|226321349|ref|ZP_03796876.1| preprotein translocase, YajC subunit [Borrelia burgdorferi Bol26]
 gi|6647986|sp|O51595|Y651_BORBU RecName: Full=UPF0092 membrane protein BB_0651
 gi|2688575|gb|AAC66994.1| conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|221192210|gb|EEE18430.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 72a]
 gi|223885097|gb|EEF56201.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 64b]
 gi|224512083|gb|EEF82476.1| preprotein translocase, YajC subunit [Borrelia burgdorferi WI91-23]
 gi|224513490|gb|EEF83847.1| preprotein translocase, YajC subunit [Borrelia burgdorferi
           CA-11.2a]
 gi|225370587|gb|EEH00024.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 94a]
 gi|226233145|gb|EEH31897.1| preprotein translocase, YajC subunit [Borrelia burgdorferi Bol26]
 gi|226234213|gb|EEH32925.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 29805]
 gi|312147854|gb|ADQ30513.1| preprotein translocase, YajC subunit [Borrelia burgdorferi JD1]
 gi|312149345|gb|ADQ29416.1| preprotein translocase, YajC subunit [Borrelia burgdorferi N40]
          Length = 105

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 57/90 (63%), Gaps = 1/90 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +  +S L    +F  +  +++FL+I PQR++ + + EM++NL++GD ++T  GI G VV+
Sbjct: 15  SGNSSFLRSLLVFVPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGDKVLTIGGIFG-VVK 73

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
            + D ++ +E++ N     +++ + +V S+
Sbjct: 74  KLGDTDVILELSPNNEAVFIKNSIDKVLSE 103


>gi|227894654|ref|ZP_04012459.1| protein translocase [Lactobacillus ultunensis DSM 16047]
 gi|227863549|gb|EEJ70970.1| protein translocase [Lactobacillus ultunensis DSM 16047]
          Length = 137

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
             M  LF VL    YF +IRPQ++Q Q+R +M+  L++GD ++   G+ GK+ ++  D  
Sbjct: 20  WLMILLFIVLIGFTYFGMIRPQKKQQQQRLQMMDKLKKGDEVILVDGLHGKIDKINSDKT 79

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
           + ++ A+ + +   R  +  V   + P
Sbjct: 80  VVID-ADGIYLTFERMAIRRVIPSAAP 105


>gi|283781748|ref|YP_003372503.1| preprotein translocase YajC subunit [Pirellula staleyi DSM 6068]
 gi|283440201|gb|ADB18643.1| preprotein translocase, YajC subunit [Pirellula staleyi DSM 6068]
          Length = 138

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 50/102 (49%), Gaps = 5/102 (4%)

Query: 5   VYAQSDAPAITSATS--PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           + AQ  A     A              + +V+Y ++IRP +++ + +   L +L+  D +
Sbjct: 22  LLAQQGAAPKGDAGGLESYLTFLPIVAIVMVFYLIMIRPDQKKRKEKEAALASLKVNDHV 81

Query: 63  VTAAGIVGKVVRVI-DDLELEVEIAE--NVRVRVVRSFVSEV 101
           VT  GI G VV +  +   + + + +    +++V+RS +S+V
Sbjct: 82  VTIGGIAGTVVNISAEAKFVTIRVDDKTGTKIKVLRSAISQV 123


>gi|76664648|emb|CAI77476.1| protein translocase [Lactobacillus reuteri]
          Length = 87

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 34/78 (43%)

Query: 11 APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
            A ++  S      L  ++  + YF +IRPQ++Q +   EM+  L  GD +VT   + G
Sbjct: 10 GAASSNNASGYSGIILIILMVALMYFFMIRPQQKQRKEHQEMMNELHPGDEVVTIGRMHG 69

Query: 71 KVVRVIDDLELEVEIAEN 88
          K+  +           E 
Sbjct: 70 KIDSINKADRTVTLDCEG 87


>gi|329889964|ref|ZP_08268307.1| preprotein translocase, YajC subunit [Brevundimonas diminuta ATCC
           11568]
 gi|328845265|gb|EGF94829.1| preprotein translocase, YajC subunit [Brevundimonas diminuta ATCC
           11568]
          Length = 104

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 61/96 (63%), Gaps = 1/96 (1%)

Query: 10  DAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69
            A       + +        + +++YFL+IRPQ+++++    ++  ++RGD +V + G+V
Sbjct: 2   TATQDGGLMALVIQIAPIVAIFILFYFLMIRPQQKRMKAHQALIAGVKRGDEVVLSNGMV 61

Query: 70  GKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           GKV RV +D E  VEI++ V VRVV++ ++EV++++
Sbjct: 62  GKVTRV-EDAEAMVEISQGVNVRVVKAMIAEVRNRT 96


>gi|282879286|ref|ZP_06288031.1| preprotein translocase, YajC subunit [Prevotella buccalis ATCC
          35310]
 gi|281298568|gb|EFA90992.1| preprotein translocase, YajC subunit [Prevotella buccalis ATCC
          35310]
          Length = 105

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
          A  +A     M  L   +  + +  +IRPQ+++ +        L+ G  ++   GI G V
Sbjct: 7  AAQAAGGGTSMLILMVAMLAIMWLFMIRPQQKKQKEIRNFQNALQEGSKVIINGGIYGTV 66

Query: 73 VRVI-DDLELEVEIAENVRVRVVRSF 97
           R+     +++VEIA  V V+V R+F
Sbjct: 67 KRIDLTTNKVDVEIARGVTVQVDRNF 92


>gi|149370657|ref|ZP_01890346.1| preprotein translocase, YajC subunit [unidentified eubacterium
          SCB49]
 gi|149356208|gb|EDM44765.1| preprotein translocase, YajC subunit [unidentified eubacterium
          SCB49]
          Length = 97

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 18 TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
             +       +L  V Y  LIRPQ ++ ++       L++GD +VT +G+ GK++ +  
Sbjct: 1  MGDITSFLPMILLFAVMYLFLIRPQMKKQKKEKAFADELKKGDKVVTKSGLHGKILDLNT 60

Query: 78 DLELEVEIAENVRVRVVRSFVS 99
          D    +E     +++   S +S
Sbjct: 61 DGTCILESGAG-KLKFETSALS 81


>gi|317011774|gb|ADU85521.1| preprotein translocase subunit YajC [Helicobacter pylori
           SouthAfrica7]
          Length = 97

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                 +       V+ +++YFL+IRPQRQQ ++  EM+  L +GD IVT  G++ +V++
Sbjct: 2   GQTKDIITTFLPLVVILLIFYFLIIRPQRQQQKKHREMIEGLTKGDKIVTQGGLIVEVLK 61

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             +     V++ ++   ++ +++++    +  
Sbjct: 62  A-EANFFSVKLNDDTTAKLSKNYIAFKLDEET 92


>gi|148269213|ref|YP_001243673.1| preprotein translocase, YajC subunit [Thermotoga petrophila RKU-1]
 gi|281411511|ref|YP_003345590.1| preprotein translocase, YajC subunit [Thermotoga naphthophila
           RKU-10]
 gi|147734757|gb|ABQ46097.1| protein translocase subunit yajC [Thermotoga petrophila RKU-1]
 gi|281372614|gb|ADA66176.1| preprotein translocase, YajC subunit [Thermotoga naphthophila
           RKU-10]
          Length = 116

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 1   MFTTVYAQSDAPA-----ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRN 55
           M   +YA +   +      T+      +  +      ++YF++I PQR++ ++  +M+  
Sbjct: 1   MPEIIYAAAPGASNGTTTTTTGGGWGSLLFMLIFFIAIFYFMIILPQRRREKQFQQMISQ 60

Query: 56  LRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
           ++RGD++VT  GIVGKV+ +  D  ++++ A +  + + +  +S V  +
Sbjct: 61  MKRGDTVVTIGGIVGKVIDIKKD-TVKIKTANSTELEITKRAISTVIKE 108


>gi|225549998|ref|ZP_03770959.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 118a]
 gi|225369457|gb|EEG98909.1| preprotein translocase, YajC subunit [Borrelia burgdorferi 118a]
          Length = 102

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 57/90 (63%), Gaps = 1/90 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +  +S L    +F  +  +++FL+I PQR++ + + EM++NL++GD ++T  GI G VV+
Sbjct: 12  SGNSSFLRSLLVFVPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGDKVLTIGGIFG-VVK 70

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
            + D ++ +E++ N     +++ + +V S+
Sbjct: 71  KLGDTDVILELSPNNEAVFIKNSIDKVLSE 100


>gi|224418270|ref|ZP_03656276.1| preprotein translocase subunit YajC [Helicobacter canadensis MIT
           98-5491]
 gi|253827594|ref|ZP_04870479.1| preprotein translocase, YajC subunit [Helicobacter canadensis MIT
           98-5491]
 gi|313141803|ref|ZP_07803996.1| preprotein translocase subunit YajC [Helicobacter canadensis MIT
           98-5491]
 gi|253511000|gb|EES89659.1| preprotein translocase, YajC subunit [Helicobacter canadensis MIT
           98-5491]
 gi|313130834|gb|EFR48451.1| preprotein translocase subunit YajC [Helicobacter canadensis MIT
           98-5491]
          Length = 89

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 49/84 (58%), Gaps = 1/84 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           A +         VL  ++YFL+IRPQ++Q +   EM+ +L +GD IVT  G + +VV+  
Sbjct: 4   AGNIFTQLLPLVVLIAIFYFLIIRPQQKQAKNHREMIASLNKGDKIVTTGGFIVEVVK-R 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSE 100
           ++    V + E+  V++ + +V++
Sbjct: 63  EEDYFMVRLNEDTIVKLAKDYVAK 86


>gi|162139916|ref|YP_712370.2| hypothetical protein FRAAL2142 [Frankia alni ACN14a]
          Length = 171

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 4/103 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M   V A + A     ++    +  L  VLAVV+ F +   QR++ + + + +  L  G 
Sbjct: 1   MRGLVTAATAADGNGGSSIGGFLIPLLLVLAVVYIFSM---QRRRAKAQQQQVSQLLPGT 57

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            ++T AG+   VV + +D ++ +EIA +V  R  RS ++ V S
Sbjct: 58  LVITTAGLYATVVEL-EDGDVLLEIAPDVVCRFTRSAIARVIS 99


>gi|57241994|ref|ZP_00369934.1| preprotein translocase, YajC subunit [Campylobacter upsaliensis
           RM3195]
 gi|315638281|ref|ZP_07893462.1| preprotein translocase [Campylobacter upsaliensis JV21]
 gi|57017186|gb|EAL53967.1| preprotein translocase, YajC subunit [Campylobacter upsaliensis
           RM3195]
 gi|315481628|gb|EFU72251.1| preprotein translocase [Campylobacter upsaliensis JV21]
          Length = 90

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 51/86 (59%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S L       VL  ++YFL+IRPQ++Q +   +ML +L++GD I+T  G++ +V++  +D
Sbjct: 5   SILTSLLPLIVLFAIFYFLVIRPQQKQAKAHKQMLESLQKGDKIITNGGLICEVIKPEED 64

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSK 104
                   EN+  R+ R FV++  ++
Sbjct: 65  FIKVKLNEENITARISREFVAKKINE 90


>gi|315608440|ref|ZP_07883428.1| preprotein translocase [Prevotella buccae ATCC 33574]
 gi|315249900|gb|EFU29901.1| preprotein translocase [Prevotella buccae ATCC 33574]
          Length = 101

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 11 APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
          A         +    +   +  + +F ++RPQ+++ +       +L+ G  +VT  G+ G
Sbjct: 4  AAQAAQGGGSMTFLIMMIAIFAIIWFFMMRPQQKRQKEIRNFQNSLQNGTEVVTQGGVHG 63

Query: 71 KVVRVI-DDLELEVEIAENVRVRVVRSFV 98
           V  V  +   +EVEIA  V + V ++ V
Sbjct: 64 TVKSVDLNTNTVEVEIARGVIITVEKNCV 92


>gi|84688038|ref|ZP_01015899.1| Putative preprotein translocase subunit YajC [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84663944|gb|EAQ10447.1| Putative preprotein translocase subunit YajC [Rhodobacterales
           bacterium HTCC2654]
          Length = 114

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/91 (41%), Positives = 58/91 (63%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
                 M     ++  + YF LIRPQ+++++   +M   LRRGD +VT  GI+GKV +V 
Sbjct: 15  GGLMNSMLIPMVLVFGIMYFFLIRPQQKKVKEDQKMREALRRGDQVVTQGGIIGKVSKVK 74

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
           +  E+EVEIAE V+VRV ++ + +V SK+EP
Sbjct: 75  EGEEVEVEIAEGVKVRVTKAAILQVVSKTEP 105


>gi|91216594|ref|ZP_01253560.1| YajC [Psychroflexus torquis ATCC 700755]
 gi|91185388|gb|EAS71765.1| YajC [Psychroflexus torquis ATCC 700755]
          Length = 110

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 44/82 (53%)

Query: 18 TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
             L       ++ VV YF +IRPQ ++ ++    + +++RGD +VT +G+ GK+  + +
Sbjct: 1  MDQLGSLLPLVLIFVVLYFFMIRPQMKKQKKEKSFIESIKRGDKVVTKSGLHGKIADLSE 60

Query: 78 DLELEVEIAENVRVRVVRSFVS 99
           L+  +    + ++   +S +S
Sbjct: 61 KLDAVILETGSGKMTFDKSSLS 82


>gi|282919412|ref|ZP_06327147.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           C427]
 gi|282317222|gb|EFB47596.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           C427]
          Length = 86

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 38/83 (45%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
             +     ++  V YFL+IRPQ+++ ++  E++ N++ G  I T  GI G V  V +   
Sbjct: 3   FSLLIYIVLIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDETTV 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           +         +   +  + +V  
Sbjct: 63  VITVNGHGTELTFEKPAIKQVDP 85


>gi|295092905|emb|CBK81996.1| protein translocase subunit yajC [Coprococcus sp. ART55/1]
          Length = 124

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 55/97 (56%), Gaps = 2/97 (2%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
               +  +S + +     + A + YF++IRPQ++Q  +  +ML  +  GD+I+T +G  G
Sbjct: 13  GTQASGGSSVMFIVVYIAIFAAIIYFMMIRPQKKQKAKTDQMLSQMEPGDNIMTTSGFYG 72

Query: 71  KVVRVIDDLELEVE--IAENVRVRVVRSFVSEVQSKS 105
            ++ V+DD  + VE    +N R+ + +S V+E++ + 
Sbjct: 73  TILDVVDDSTIIVEFGNNKNCRIPMHKSAVAELEKQG 109


>gi|224534513|ref|ZP_03675089.1| preprotein translocase, YajC subunit [Borrelia spielmanii A14S]
 gi|224514190|gb|EEF84508.1| preprotein translocase, YajC subunit [Borrelia spielmanii A14S]
          Length = 104

 Score = 80.6 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 59/94 (62%), Gaps = 1/94 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +  +S L    +F  +  +++FL+I PQR++ + + EM++NL++GD ++T  GI G VV+
Sbjct: 8   SGNSSFLRSFLVFVPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGDKVLTIGGIFG-VVK 66

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            + D ++ +E++ N+    +++ + +V S+   V
Sbjct: 67  KLGDTDVILELSPNIEAVFIKNSIDKVLSEKNEV 100


>gi|312868043|ref|ZP_07728247.1| preprotein translocase, YajC subunit [Streptococcus parasanguinis
           F0405]
 gi|311096447|gb|EFQ54687.1| preprotein translocase, YajC subunit [Streptococcus parasanguinis
           F0405]
          Length = 108

 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                +  +  ++  + YF + R Q++Q Q+R E L  L++G+ ++T  G+ G +  V  
Sbjct: 1   MQGGSLLIMLVLMVGLMYF-MSRSQKKQYQKRMESLNKLQKGNEVITIGGLYGTIDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +      +  V   SE
Sbjct: 60  DRKTVVLDVDGVYLTFELGAIKTVLPVSE 88


>gi|163816442|ref|ZP_02207806.1| hypothetical protein COPEUT_02631 [Coprococcus eutactus ATCC 27759]
 gi|158448142|gb|EDP25137.1| hypothetical protein COPEUT_02631 [Coprococcus eutactus ATCC 27759]
          Length = 123

 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 30  LAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE--IAE 87
              + YF +IRPQ++Q  +  +M + +  GD+I+T +G  G V+ V+DD  + VE    +
Sbjct: 34  FGAIIYFFMIRPQKKQQAKTQDMQKRIEPGDNIMTTSGFYGTVLDVVDDTTIIVEFGNNK 93

Query: 88  NVRVRVVRSFVSEVQSKSEPV 108
           N R+ + +S V+E++ +   V
Sbjct: 94  NCRIPMHKSAVAELEKQGSAV 114


>gi|255534374|ref|YP_003094745.1| Preprotein translocase subunit YajC [Flavobacteriaceae bacterium
           3519-10]
 gi|255340570|gb|ACU06683.1| Preprotein translocase subunit YajC [Flavobacteriaceae bacterium
           3519-10]
          Length = 109

 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 54/100 (54%), Gaps = 7/100 (7%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M + ++ Q+ AP  T     +    +  ++ V +YFL+IRPQ ++ ++       L+ G 
Sbjct: 1   MIS-IFLQAAAPEST----MMPTMIMMGLMFVGFYFLMIRPQMKKAKQEKGFQAALKVGS 55

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
            +VT +G+ G++ ++++D  +   ++   +++  ++ +S 
Sbjct: 56  RVVTTSGMHGRIAQIMEDGVVIETLSG--KLKFEKAAISR 93


>gi|119716615|ref|YP_923580.1| protein translocase subunit yajC [Nocardioides sp. JS614]
 gi|119537276|gb|ABL81893.1| protein translocase subunit yajC [Nocardioides sp. JS614]
          Length = 103

 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +        +A++++  +IRP  ++ +    M  +L  GD IV  +G+ G V  + +D  
Sbjct: 1   MLELLPLVGIALLFWLFIIRPASRRQKELGRMQSSLSLGDEIVLTSGVYGTVRDI-EDGH 59

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           + VEIA  V ++VVR  V  + +K++
Sbjct: 60  VLVEIASGVTIKVVRGAVGSIATKAD 85


>gi|110598619|ref|ZP_01386886.1| preprotein translocase, YajC subunit [Chlorobium ferrooxidans DSM
           13031]
 gi|110339788|gb|EAT58296.1| preprotein translocase, YajC subunit [Chlorobium ferrooxidans DSM
           13031]
          Length = 117

 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD-L 79
                   ++ VV+YF +IRPQ+++ + + ++L +L+RGD +VT  GI G V  +  D  
Sbjct: 23  FLQIVPMVLIFVVFYFFMIRPQQKKQKEKEKVLDSLKRGDKVVTIGGIHGTVAGIDSDKK 82

Query: 80  ELEVEIAENVRVRVVRSFVSEV 101
            + V++ E  +++  RS V+ +
Sbjct: 83  TVLVQVNETTKIKFDRSAVANI 104


>gi|225551840|ref|ZP_03772783.1| preprotein translocase, YajC subunit [Borrelia sp. SV1]
 gi|225371635|gb|EEH01062.1| preprotein translocase, YajC subunit [Borrelia sp. SV1]
          Length = 102

 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 57/90 (63%), Gaps = 1/90 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +  ++ L    +F  +  +++FL+I PQR++ + + EM++NL++GD ++T  GI G VV+
Sbjct: 12  SGNSNFLRSLLVFVPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGDKVLTIGGIFG-VVK 70

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
            + D ++ +E++ N     +++ + +V S+
Sbjct: 71  KLGDTDVILELSPNNEAVFIKNSIDKVLSE 100


>gi|307638222|gb|ADN80672.1| Preprotein translocase subunit [Helicobacter pylori 908]
 gi|325996816|gb|ADZ52221.1| Preprotein translocase subunit [Helicobacter pylori 2018]
 gi|325998408|gb|ADZ50616.1| Preprotein translocase subunit [Helicobacter pylori 2017]
          Length = 97

 Score = 80.6 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                 +     F VL +++YFL++RPQRQQ ++  EM+  L +GD IVT  G++ +V++
Sbjct: 2   GQTKEIITTLLPFLVLFLIFYFLIVRPQRQQQKKHKEMIEGLTKGDKIVTQGGLIVEVLK 61

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             +     V++ ++   R+ +++V+    +  
Sbjct: 62  A-EANFFSVKLNDDTTARLSKNYVAFKLDEET 92


>gi|322390831|ref|ZP_08064341.1| preprotein translocase subunit YajC [Streptococcus parasanguinis
           ATCC 903]
 gi|321142501|gb|EFX37969.1| preprotein translocase subunit YajC [Streptococcus parasanguinis
           ATCC 903]
          Length = 108

 Score = 80.6 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                +  +  ++  + YF + R Q++Q Q+R E L  L++G+ ++T  G+ G +  V  
Sbjct: 1   MQGGSLLIMLVLMVGLMYF-MSRSQKKQYQKRMESLNKLQKGNEVITIGGLYGTIDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +      +  V   SE
Sbjct: 60  DRKTVVLDVDGVYLTFELGAIKTVLPVSE 88


>gi|120436862|ref|YP_862548.1| YajC family protein [Gramella forsetii KT0803]
 gi|117579012|emb|CAL67481.1| YajC family protein [Gramella forsetii KT0803]
          Length = 100

 Score = 80.6 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 41/87 (47%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              L       ++ VV YF +IRPQ ++ ++       L++GD ++T +G+ GK++   +
Sbjct: 1   MDQLTQFAPIILMFVVVYFFMIRPQMKKAKQEKNFAAELKKGDRVITKSGMHGKIIDFSE 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSK 104
                +      ++   RS +S   SK
Sbjct: 61  KNNSVIIETGAGKITFDRSSISMEMSK 87


>gi|119713218|gb|ABL97285.1| possible preprotein translocase YajC subunit [uncultured marine
           bacterium HF10_05C07]
          Length = 103

 Score = 80.2 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             S++       L     +  YFL+IRPQ ++++ + EM+ NL  GD IV + GIVG ++
Sbjct: 9   AQSSSFLGPQLILIGGFFLFIYFLIIRPQNKRMKAQKEMIENLSVGDEIVISGGIVGSIL 68

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           ++ ++       A N  + + RS VS V  K  
Sbjct: 69  KISENFLTI--RANNSELIIQRSAVSSVLPKGT 99


>gi|296126606|ref|YP_003633858.1| preprotein translocase, YajC subunit [Brachyspira murdochii DSM
           12563]
 gi|296018422|gb|ADG71659.1| preprotein translocase, YajC subunit [Brachyspira murdochii DSM
           12563]
          Length = 142

 Score = 80.2 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MFT       A    +  SPL   G+  V+  ++YFLLIRPQ+QQ ++ A+ +  L++GD
Sbjct: 1   MFTATLYAQTAQGAQAGGSPLVSIGMMVVIFAIFYFLLIRPQKQQQKKLAQSIAELKKGD 60

Query: 61  SIVTAAGIVGKVVRVIDDLEL-EVEIAENVRVRVVRSFVSEVQSK 104
            I+ + GI+ + +   +   +  V++ EN ++ +++S +S V ++
Sbjct: 61  KIIVSGGIIAEYISDKEGGRIAVVKVGENTKMEIIKSSISAVVTE 105


>gi|109946903|ref|YP_664131.1| preprotein translocase subunit YajC [Helicobacter acinonychis
          str. Sheeba]
 gi|109714124|emb|CAJ99132.1| preprotein translocase YajC subunit [Helicobacter acinonychis
          str. Sheeba]
          Length = 96

 Score = 80.2 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 16 SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
               +     F V  +++YFL+ RPQRQQ ++  EM+ +L +GD IVT  G++ +V++ 
Sbjct: 2  GTRDIITTLLPFVVFLLIFYFLIFRPQRQQQKKHREMIESLTKGDKIVTQGGLIVEVLKA 61

Query: 76 IDDLELEVEIAENVRVRVVRSFVS 99
           +     V+++++   ++ +++++
Sbjct: 62 -EANFFSVKLSDDSTAKLSKNYIA 84


>gi|158320750|ref|YP_001513257.1| preprotein translocase, YajC subunit [Alkaliphilus oremlandii
           OhILAs]
 gi|158140949|gb|ABW19261.1| preprotein translocase, YajC subunit [Alkaliphilus oremlandii
           OhILAs]
          Length = 94

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 49/85 (57%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             + +    L   + VV+YF+LIRPQ+++ ++  EM  NL+ GD ++T  GI GKV ++ 
Sbjct: 1   MPAAVANLVLPLGVFVVFYFILIRPQQKKDKKIKEMRNNLKVGDEVITIGGIHGKVTKIK 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEV 101
           +D+      A+ V++ + +  V  V
Sbjct: 61  EDIMTLEVGADKVKLTMSKWAVGTV 85


>gi|288928413|ref|ZP_06422260.1| preprotein translocase, YajC subunit [Prevotella sp. oral taxon
          317 str. F0108]
 gi|288331247|gb|EFC69831.1| preprotein translocase, YajC subunit [Prevotella sp. oral taxon
          317 str. F0108]
          Length = 103

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 23 MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV-IDDLEL 81
             +   +  + YF +IRPQ+++ +        L+ G  +VT+ G+ G V R+ I+   +
Sbjct: 13 PILMMVAIFAIMYFFMIRPQQKKQKAIRNFQNALQEGTRVVTSGGVYGDVKRINIESNTV 72

Query: 82 EVEIAENVRVRVVRSFV 98
          E+EIA  V V V R++V
Sbjct: 73 ELEIARGVVVTVDRNYV 89


>gi|256375829|ref|YP_003099489.1| preprotein translocase, YajC subunit [Actinosynnema mirum DSM
           43827]
 gi|255920132|gb|ACU35643.1| preprotein translocase, YajC subunit [Actinosynnema mirum DSM
           43827]
          Length = 133

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 39/80 (48%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M  L  +L  V  FL  R Q++    + E+L  L  GD ++T +G+   V    D+  ++
Sbjct: 7   MFPLLLILFAVPLFLSARKQKKAAAEQQELLSALEPGDRVMTTSGLFATVADASDEATID 66

Query: 83  VEIAENVRVRVVRSFVSEVQ 102
           +E+A+ V    +R  V E  
Sbjct: 67  LEVADGVVTTWLRQAVREKV 86


>gi|86740078|ref|YP_480478.1| protein translocase subunit yajC [Frankia sp. CcI3]
 gi|86566940|gb|ABD10749.1| protein translocase subunit yajC [Frankia sp. CcI3]
          Length = 155

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 7   AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAA 66
           A S A      +S   +     ++ V+ YF  +  QR++ + + + +  +  G  ++T A
Sbjct: 6   AASVAAGKDGGSSISGLLFPLILILVIVYFFSM--QRRRAKAQQQQISRIVPGTLVMTTA 63

Query: 67  GIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           G+   VV + +D +L +E+A +V  R  RS V+ V S
Sbjct: 64  GLYATVVEM-EDGDLLLEVAPDVVCRFSRSAVARVIS 99


>gi|332674349|gb|AEE71166.1| preprotein translocase [Helicobacter pylori 83]
          Length = 97

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 15 TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                L     F VL +++YFL++RPQRQQ ++  EM+  L +GD IVT  G++ +V++
Sbjct: 2  GQTKDILTTLLPFVVLFLIFYFLIVRPQRQQQKKHKEMIEGLTKGDKIVTQGGLIVEVLK 61

Query: 75 VIDDLELEVEIAENVRVRVVRSFVS 99
            +     V++ ++   ++ +++++
Sbjct: 62 A-EANFFSVKLNDDTTAKLSKNYIA 85


>gi|217076330|ref|YP_002334046.1| membrane protein [Thermosipho africanus TCF52B]
 gi|217036183|gb|ACJ74705.1| membrane protein [Thermosipho africanus TCF52B]
          Length = 130

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 52/84 (61%), Gaps = 1/84 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
             +M  L  +  V+ YFL+I PQR++ +   +M+  ++RGD+I+T+ GIVGKV+ V  D 
Sbjct: 30  LFQMLFLLLIFFVMMYFLVILPQRKREKEFKKMISEIKRGDTIITSGGIVGKVIDVKKD- 88

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
            L+++ +    + V + ++S+V  
Sbjct: 89  TLKIKTSNTTELEVAKVYISKVLK 112


>gi|73749068|ref|YP_308307.1| preprotein translocase, YajC subunit [Dehalococcoides sp. CBDB1]
 gi|147669833|ref|YP_001214651.1| protein translocase subunit yajC [Dehalococcoides sp. BAV1]
 gi|289433045|ref|YP_003462918.1| preprotein translocase, YajC subunit [Dehalococcoides sp. GT]
 gi|73660784|emb|CAI83391.1| preprotein translocase, YajC subunit [Dehalococcoides sp. CBDB1]
 gi|146270781|gb|ABQ17773.1| protein translocase subunit yajC [Dehalococcoides sp. BAV1]
 gi|288946765|gb|ADC74462.1| preprotein translocase, YajC subunit [Dehalococcoides sp. GT]
          Length = 92

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 21 LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
          + M  L  +   ++YFL+IRPQRQ+ +  A ++ ++ +GD ++T  GI G +  V +D  
Sbjct: 6  ITMFVLLALFFGMFYFLIIRPQRQRQKDHANLMSSIAKGDGVITIGGIHGVIESVAEDS- 64

Query: 81 LEVEIAENVRVRVVRSFV 98
          + +++     ++V R  +
Sbjct: 65 VVIKVESGTLLKVSRGAI 82


>gi|295425860|ref|ZP_06818540.1| preprotein translocase [Lactobacillus amylolyticus DSM 11664]
 gi|295064463|gb|EFG55391.1| preprotein translocase [Lactobacillus amylolyticus DSM 11664]
          Length = 152

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 46/92 (50%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
                 +S + M  +F +L    YF +IRPQ++Q Q+R +M+  L++GD +V   G+ GK
Sbjct: 10  ANAQGGSSNIMMIVVFVILIGFMYFGMIRPQKKQQQKRMQMMDQLKKGDRVVLVDGLHGK 69

Query: 72  VVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
           V  +       V  A+ + +   R  + +V  
Sbjct: 70  VDSINGKDNTVVIDADGIYLTFSRMAIRQVLP 101


>gi|57233883|ref|YP_182094.1| preprotein translocase, YajC subunit [Dehalococcoides ethenogenes
          195]
 gi|57224331|gb|AAW39388.1| preprotein translocase, YajC subunit [Dehalococcoides ethenogenes
          195]
          Length = 92

 Score = 80.2 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 21 LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
          + M  L  +   ++YFL+IRPQRQ+ +  A ++ +L +GD ++T  GI G +  V +D  
Sbjct: 6  IMMFVLLALFFGMFYFLIIRPQRQRQKDHATLMSSLVKGDGVITIGGIHGVIESVAEDS- 64

Query: 81 LEVEIAENVRVRVVRSFV 98
          + +++     ++V R  +
Sbjct: 65 VVIKVESGTLLKVSRGAI 82


>gi|241896596|ref|ZP_04783892.1| preprotein translocase, YajC subunit [Weissella paramesenteroides
           ATCC 33313]
 gi|241870188|gb|EER73939.1| preprotein translocase, YajC subunit [Weissella paramesenteroides
           ATCC 33313]
          Length = 129

 Score = 80.2 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 40/82 (48%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +  V     YF++IRPQ++  ++R  M+ +++ G  ++T  G+ G +  V  +     
Sbjct: 5   ILILVVFIAAMYFIMIRPQQKAQKKRQAMINDVQPGAEVITIGGLHGTIAAVNKEARTFD 64

Query: 84  EIAENVRVRVVRSFVSEVQSKS 105
             AE V +    S + +V  ++
Sbjct: 65  LDAEGVILVFELSAIRQVVKEA 86


>gi|260912452|ref|ZP_05918989.1| preprotein translocase [Prevotella sp. oral taxon 472 str. F0295]
 gi|260633424|gb|EEX51577.1| preprotein translocase [Prevotella sp. oral taxon 472 str. F0295]
          Length = 109

 Score = 80.2 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 23 MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV-IDDLEL 81
             +   +  + YF +IRPQ+++ +        L+ G  +VT+ G+ G+V R+ I++  +
Sbjct: 19 PILMMVAIFAIMYFFMIRPQQKKQKAIRNFQNALQEGARVVTSGGVYGEVKRINIENNTV 78

Query: 82 EVEIAENVRVRVVRSFV 98
          E+E+A  V V V R++V
Sbjct: 79 ELEVARGVVVTVDRNYV 95


>gi|153812220|ref|ZP_01964888.1| hypothetical protein RUMOBE_02618 [Ruminococcus obeum ATCC 29174]
 gi|149831627|gb|EDM86714.1| hypothetical protein RUMOBE_02618 [Ruminococcus obeum ATCC 29174]
          Length = 98

 Score = 80.2 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 16  SATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRV 75
           S  S   M     V+  V YFL+IRPQ+++ +R   ML ++  GDSIVT  G  G ++ +
Sbjct: 4   STASMGMMILWMVVIFGVMYFLMIRPQKKEQKRLQAMLNSMEVGDSIVTTGGFYGVIIDM 63

Query: 76  I-DDLELEVEIAENVRVRVVRSFVSEV 101
             +D+ +E    +N R+ + +  ++EV
Sbjct: 64  TEEDVIVEFGNNKNCRIPMRKQAIAEV 90


>gi|146299959|ref|YP_001194550.1| preprotein translocase, YajC subunit [Flavobacterium johnsoniae
          UW101]
 gi|146154377|gb|ABQ05231.1| protein translocase subunit yajC [Flavobacterium johnsoniae
          UW101]
          Length = 91

 Score = 80.2 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 18 TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
             L     F ++ VV YF +IRPQ+++ +   E   +L+ GD IVT +G  GK+  + +
Sbjct: 1  MGQLSQFAPFLLMFVVIYFFMIRPQQKRAKNEKEFESSLKVGDKIVTKSGFHGKIAELAE 60

Query: 78 DLELEVEIAENVRVRVVRSFVS 99
             + +E     ++++ RS +S
Sbjct: 61 -TTVVIETMSG-KLKLERSAIS 80


>gi|15924628|ref|NP_372162.1| hypothetical protein SAV1638 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927218|ref|NP_374751.1| hypothetical protein SA1464 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283317|ref|NP_646405.1| hypothetical protein MW1588 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49483882|ref|YP_041106.1| hypothetical protein SAR1718 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49486471|ref|YP_043692.1| hypothetical protein SAS1574 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650519|ref|YP_186532.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus COL]
 gi|82751236|ref|YP_416977.1| hypothetical protein SAB1507c [Staphylococcus aureus RF122]
 gi|87161434|ref|YP_494289.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195449|ref|YP_500253.1| preprotein translocase subunit YajC [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148268118|ref|YP_001247061.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394186|ref|YP_001316861.1| preprotein translocase subunit YajC [Staphylococcus aureus subsp.
           aureus JH1]
 gi|151221752|ref|YP_001332574.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156979956|ref|YP_001442215.1| hypothetical protein SAHV_1625 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509864|ref|YP_001575523.1| type I general secretory pathway preprotein translocase subunit
           YajC [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141093|ref|ZP_03565586.1| type I general secretory pathway preprotein translocase subunit
           YajC [Staphylococcus aureus subsp. aureus str. JKD6009]
 gi|253317211|ref|ZP_04840424.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732294|ref|ZP_04866459.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733111|ref|ZP_04867276.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006423|ref|ZP_05145024.2| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257425762|ref|ZP_05602186.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428422|ref|ZP_05604820.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431060|ref|ZP_05607439.1| translocase subunit yajC [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433746|ref|ZP_05610104.1| preprotein translocase [Staphylococcus aureus subsp. aureus E1410]
 gi|257436661|ref|ZP_05612705.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793711|ref|ZP_05642690.1| preprotein translocase, YajC subunit [Staphylococcus aureus A9781]
 gi|258410990|ref|ZP_05681270.1| preprotein translocase subunit YajC [Staphylococcus aureus A9763]
 gi|258420209|ref|ZP_05683164.1| preprotein translocase subunit [Staphylococcus aureus A9719]
 gi|258424063|ref|ZP_05686945.1| preprotein translocase subunit [Staphylococcus aureus A9635]
 gi|258438211|ref|ZP_05689495.1| type I general secretory pathway translocase subunit YajC
           [Staphylococcus aureus A9299]
 gi|258443674|ref|ZP_05692013.1| translocase [Staphylococcus aureus A8115]
 gi|258446881|ref|ZP_05695035.1| type I general secretory pathway preprotein translocase subunit
           YajC [Staphylococcus aureus A6300]
 gi|258448795|ref|ZP_05696907.1| translocase subunit yajC [Staphylococcus aureus A6224]
 gi|258450536|ref|ZP_05698598.1| translocase subunit yajC [Staphylococcus aureus A5948]
 gi|258453751|ref|ZP_05701726.1| preprotein translocase subunit [Staphylococcus aureus A5937]
 gi|262048627|ref|ZP_06021510.1| hypothetical protein SAD30_1023 [Staphylococcus aureus D30]
 gi|262051288|ref|ZP_06023512.1| hypothetical protein SA930_1719 [Staphylococcus aureus 930918-3]
 gi|269203263|ref|YP_003282532.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893142|ref|ZP_06301376.1| preprotein translocase subunit [Staphylococcus aureus A8117]
 gi|282904218|ref|ZP_06312106.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus C160]
 gi|282906044|ref|ZP_06313899.1| type I general secretory pathway preprotein translocase subunit
           YajC [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282908957|ref|ZP_06316775.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911274|ref|ZP_06319076.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914443|ref|ZP_06322229.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus M899]
 gi|282916906|ref|ZP_06324664.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           D139]
 gi|282920187|ref|ZP_06327912.1| preprotein translocase subunit [Staphylococcus aureus A9765]
 gi|282924789|ref|ZP_06332455.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           C101]
 gi|282928273|ref|ZP_06335878.1| preprotein translocase subunit [Staphylococcus aureus A10102]
 gi|283770712|ref|ZP_06343604.1| type I general secretory pathway preprotein translocase subunit
           YajC [Staphylococcus aureus subsp. aureus H19]
 gi|283958398|ref|ZP_06375849.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|284024694|ref|ZP_06379092.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus 132]
 gi|293503516|ref|ZP_06667363.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510535|ref|ZP_06669240.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537078|ref|ZP_06671758.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus M1015]
 gi|294848667|ref|ZP_06789413.1| preprotein translocase subunit [Staphylococcus aureus A9754]
 gi|295406759|ref|ZP_06816564.1| preprotein translocase subunit [Staphylococcus aureus A8819]
 gi|295428213|ref|ZP_06820845.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275923|ref|ZP_06858430.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297207641|ref|ZP_06924076.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245658|ref|ZP_06929523.1| preprotein translocase subunit [Staphylococcus aureus A8796]
 gi|297590819|ref|ZP_06949457.1| preprotein translocase [Staphylococcus aureus subsp. aureus MN8]
 gi|300911724|ref|ZP_07129167.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH70]
 gi|304380765|ref|ZP_07363433.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|13701436|dbj|BAB42730.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247410|dbj|BAB57800.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21204757|dbj|BAB95453.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49242011|emb|CAG40709.1| putative exported protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244914|emb|CAG43375.1| putative exported protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284705|gb|AAW36799.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus COL]
 gi|82656767|emb|CAI81196.1| probable exported protein [Staphylococcus aureus RF122]
 gi|87127408|gb|ABD21922.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87203007|gb|ABD30817.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|147741187|gb|ABQ49485.1| protein translocase subunit yajC [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946638|gb|ABR52574.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150374552|dbj|BAF67812.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156722091|dbj|BAF78508.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160368673|gb|ABX29644.1| Sec family Type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724083|gb|EES92812.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728867|gb|EES97596.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271456|gb|EEV03602.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275263|gb|EEV06750.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278263|gb|EEV08905.1| translocase subunit yajC [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281839|gb|EEV11976.1| preprotein translocase [Staphylococcus aureus subsp. aureus E1410]
 gi|257284012|gb|EEV14135.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787683|gb|EEV26023.1| preprotein translocase, YajC subunit [Staphylococcus aureus A9781]
 gi|257840140|gb|EEV64604.1| preprotein translocase subunit YajC [Staphylococcus aureus A9763]
 gi|257843920|gb|EEV68314.1| preprotein translocase subunit [Staphylococcus aureus A9719]
 gi|257845684|gb|EEV69716.1| preprotein translocase subunit [Staphylococcus aureus A9635]
 gi|257848255|gb|EEV72246.1| type I general secretory pathway translocase subunit YajC
           [Staphylococcus aureus A9299]
 gi|257851080|gb|EEV75023.1| translocase [Staphylococcus aureus A8115]
 gi|257854456|gb|EEV77405.1| type I general secretory pathway preprotein translocase subunit
           YajC [Staphylococcus aureus A6300]
 gi|257858073|gb|EEV80962.1| translocase subunit yajC [Staphylococcus aureus A6224]
 gi|257861694|gb|EEV84493.1| translocase subunit yajC [Staphylococcus aureus A5948]
 gi|257864071|gb|EEV86824.1| preprotein translocase subunit [Staphylococcus aureus A5937]
 gi|259160925|gb|EEW45945.1| hypothetical protein SA930_1719 [Staphylococcus aureus 930918-3]
 gi|259163274|gb|EEW47833.1| hypothetical protein SAD30_1023 [Staphylococcus aureus D30]
 gi|262075553|gb|ACY11526.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus ED98]
 gi|269941123|emb|CBI49509.1| putative exported protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282313155|gb|EFB43551.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           C101]
 gi|282319393|gb|EFB49745.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321624|gb|EFB51949.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus M899]
 gi|282324969|gb|EFB55279.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327221|gb|EFB57516.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331336|gb|EFB60850.1| type I general secretory pathway preprotein translocase subunit
           YajC [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282590080|gb|EFB95162.1| preprotein translocase subunit [Staphylococcus aureus A10102]
 gi|282594535|gb|EFB99520.1| preprotein translocase subunit [Staphylococcus aureus A9765]
 gi|282595836|gb|EFC00800.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus C160]
 gi|282764460|gb|EFC04586.1| preprotein translocase subunit [Staphylococcus aureus A8117]
 gi|283460859|gb|EFC07949.1| type I general secretory pathway preprotein translocase subunit
           YajC [Staphylococcus aureus subsp. aureus H19]
 gi|283470914|emb|CAQ50125.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus ST398]
 gi|283790547|gb|EFC29364.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|285817320|gb|ADC37807.1| Preprotein translocase subunit YajC [Staphylococcus aureus
           04-02981]
 gi|290919923|gb|EFD96991.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095182|gb|EFE25447.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466426|gb|EFF08947.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824693|gb|EFG41116.1| preprotein translocase subunit [Staphylococcus aureus A9754]
 gi|294968506|gb|EFG44530.1| preprotein translocase subunit [Staphylococcus aureus A8819]
 gi|295128571|gb|EFG58205.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887658|gb|EFH26556.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177309|gb|EFH36561.1| preprotein translocase subunit [Staphylococcus aureus A8796]
 gi|297575705|gb|EFH94421.1| preprotein translocase [Staphylococcus aureus subsp. aureus MN8]
 gi|298694917|gb|ADI98139.1| probable exported protein [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300885970|gb|EFK81172.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH70]
 gi|302333311|gb|ADL23504.1| Sec family Type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|304340702|gb|EFM06634.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437895|gb|ADQ76966.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH60]
 gi|312830024|emb|CBX34866.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315129923|gb|EFT85913.1| Sec family Type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus CGS03]
 gi|315195541|gb|EFU25928.1| Sec family Type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus CGS00]
 gi|315198661|gb|EFU28989.1| Sec family Type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus aureus subsp. aureus CGS01]
 gi|320140475|gb|EFW32329.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320144014|gb|EFW35783.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|329314312|gb|AEB88725.1| Protein translocase subunit yajC [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329727044|gb|EGG63500.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus 21172]
 gi|329728479|gb|EGG64916.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329733262|gb|EGG69599.1| preprotein translocase, YajC subunit [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 86

 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 38/83 (45%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
             +     V+  V YFL+IRPQ+++ ++  E++ N++ G  I T  GI G V  V +   
Sbjct: 3   FSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDETTV 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           +         +   +  + +V  
Sbjct: 63  VITVNGHGTELTFEKPAIKQVDP 85


>gi|306832693|ref|ZP_07465830.1| preprotein translocase [Streptococcus bovis ATCC 700338]
 gi|304425149|gb|EFM28278.1| preprotein translocase [Streptococcus bovis ATCC 700338]
          Length = 123

 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +    +  VL  + +F + R Q++Q Q R   L+ L +GD IVT  G+ G V  V +D +
Sbjct: 1   MGTIIMLVVLVGMIWF-MQRSQKKQAQERQNQLKALAKGDEIVTIGGLYGVVDEVDEDNQ 59

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
             V   + V +    S +  V +++EP
Sbjct: 60  KMVLDIDGVYLTFELSALKRVINRAEP 86


>gi|308183696|ref|YP_003927823.1| preprotein translocase subunit YajC [Helicobacter pylori PeCan4]
 gi|308065881|gb|ADO07773.1| preprotein translocase subunit YajC [Helicobacter pylori PeCan4]
          Length = 97

 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                 L     F VL +++YFL++RPQRQQ ++  EM+  L +GD IVT  G + +V++
Sbjct: 2   GQIKDILTTLLPFVVLFLIFYFLIVRPQRQQQKKHKEMIEGLTKGDKIVTQGGFIVEVLK 61

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
             +     V++ ++   ++ +++V+    +  
Sbjct: 62  A-EANFFSVKLNDDTTAKLSKNYVAFKLDEET 92


>gi|260588468|ref|ZP_05854381.1| preprotein translocase, YajC subunit [Blautia hansenii DSM 20583]
 gi|331082255|ref|ZP_08331382.1| preprotein translocase subunit [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260540943|gb|EEX21512.1| preprotein translocase, YajC subunit [Blautia hansenii DSM 20583]
 gi|330403049|gb|EGG82614.1| preprotein translocase subunit [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 102

 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           +   A S + +     V  ++ YF+++RPQ+++ QR   ML ++  GDS+VT +G  G +
Sbjct: 4   SAAGAGSMISLFVPLIVFFLLMYFMIMRPQKKEQQRVKSMLASMEVGDSVVTTSGFYGIL 63

Query: 73  VRVI-DDLELEVEIAENVRVRVVRSFVSEV 101
           + +  +D+ +E     N R+ + +  ++EV
Sbjct: 64  IDITEEDVIVEFGNNRNCRIPMRKGAIAEV 93


>gi|312891645|ref|ZP_07751155.1| protein translocase subunit yajC [Mucilaginibacter paludis DSM
           18603]
 gi|311295829|gb|EFQ72988.1| protein translocase subunit yajC [Mucilaginibacter paludis DSM
           18603]
          Length = 106

 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 59/105 (56%), Gaps = 7/105 (6%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M +T+  Q+   A            +  ++ VV+YF +IRPQ ++ + + + +  +++GD
Sbjct: 1   MISTILLQAAGGAQ------YTQYIMMGLIVVVFYFFMIRPQIKKQKDQKKYVDEMKKGD 54

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            IVT AGI GKVV +  D+ + VE+   V++R  +S +S   SK+
Sbjct: 55  KIVTTAGIHGKVVEIA-DVTILVEVDNGVKIRFDKSAISLEASKA 98


>gi|255994171|ref|ZP_05427306.1| preprotein translocase, YajC subunit [Eubacterium saphenum ATCC
           49989]
 gi|255993839|gb|EEU03928.1| preprotein translocase, YajC subunit [Eubacterium saphenum ATCC
           49989]
          Length = 139

 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            ++   +  V   + YFL+IRPQ+++ +    M   L+ GD ++T  G +GK++ V  D 
Sbjct: 5   MMKSVLMIAVFFAIIYFLMIRPQKKREKAVKTMRDTLQVGDEVITIGGFIGKIMSVKGDT 64

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            +    A+  ++ +++  VS+  +K E
Sbjct: 65  LVISIGADKNKLEIMKWGVSK-LAKDE 90


>gi|299140508|ref|ZP_07033646.1| preprotein translocase, YajC subunit [Prevotella oris C735]
 gi|298577474|gb|EFI49342.1| preprotein translocase, YajC subunit [Prevotella oris C735]
          Length = 102

 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 1/96 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  +    + +  +   + V+++  ++RPQ+++ ++      +L+ G  IVT  GI G +
Sbjct: 5   AQAAQGGGMGVFIMMGAILVIFWLFMVRPQQKKQKKIRNFQNSLQEGAKIVTGGGIYGTI 64

Query: 73  VRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
            RV      ++VEIA  V + V R +V E  S   P
Sbjct: 65  KRVDVSADTVDVEIARGVVITVSRGYVFEDASSQTP 100


>gi|322391233|ref|ZP_08064705.1| preprotein translocase [Streptococcus peroris ATCC 700780]
 gi|321145986|gb|EFX41375.1| preprotein translocase [Streptococcus peroris ATCC 700780]
          Length = 106

 Score = 79.8 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +  V+  +  F + R Q++Q ++R E L  L++G  ++T  G+ G V  V  + +
Sbjct: 5   LTFVIMLVVMFGLM-FFMQRSQKKQAEKRMESLNKLQKGYEVITIGGLYGTVDEVDTENK 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEPV 108
             V   + V +      +  V    E V
Sbjct: 64  TIVLDVDGVYLTFELGAIKSVLPLKEAV 91


>gi|15643622|ref|NP_228668.1| hypothetical protein TM0859 [Thermotoga maritima MSB8]
 gi|170287875|ref|YP_001738113.1| preprotein translocase, YajC subunit [Thermotoga sp. RQ2]
 gi|13634024|sp|Q9WZW3|Y859_THEMA RecName: Full=UPF0092 membrane protein TM_0859
 gi|4981393|gb|AAD35941.1|AE001752_8 hypothetical protein TM_0859 [Thermotoga maritima MSB8]
 gi|170175378|gb|ACB08430.1| preprotein translocase, YajC subunit [Thermotoga sp. RQ2]
          Length = 116

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 57/109 (52%), Gaps = 6/109 (5%)

Query: 1   MFTTVYAQSDAPA-----ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRN 55
           M   +YA +   +       +      +  +      ++YF++I PQR++ ++  +M+  
Sbjct: 1   MPEIIYAAAPGASNGTTTTATGGGWGSLLFMLIFFIAIFYFMIILPQRRREKQFQQMISQ 60

Query: 56  LRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
           ++RGD++VT  GIVGKV+ +  D  ++++ A +  + + +  +S V  +
Sbjct: 61  MKRGDTVVTIGGIVGKVIDIKKD-TVKIKTANSTELEITKRAISTVIKE 108


>gi|210612253|ref|ZP_03289201.1| hypothetical protein CLONEX_01401 [Clostridium nexile DSM 1787]
 gi|210151627|gb|EEA82634.1| hypothetical protein CLONEX_01401 [Clostridium nexile DSM 1787]
          Length = 93

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID- 77
           +P+ +   + V+   ++FLL+RPQ+++ +R   ML  L  GD+++T +G  G ++ + D 
Sbjct: 3   NPIFLLIFYAVILGGFWFLLMRPQKKEQKRIQLMLSELAVGDTVLTTSGFYGVIIDITDE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D+ +E    +N R+ + ++ +++V+  + 
Sbjct: 63  DVIVEFGNNKNCRIPMQKAAITQVEKANT 91


>gi|317052520|ref|YP_004113636.1| preprotein translocase subunit YajC [Desulfurispirillum indicum S5]
 gi|316947604|gb|ADU67080.1| preprotein translocase, YajC subunit [Desulfurispirillum indicum
           S5]
          Length = 92

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                      ++  +++FL+I PQR+Q ++  +M+ NL+ GD IVT  G  G V RV  
Sbjct: 1   MEGFSALIPLILMFAIFWFLIIAPQRKQRKKHQDMVNNLQVGDEIVTLGGFYGHVTRVEP 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +  + V++ +N+  ++ R  V+EV  K++
Sbjct: 61  E-VIFVKLGQNMEAKLRRMNVAEVVRKAQ 88


>gi|296877239|ref|ZP_06901279.1| preprotein translocase [Streptococcus parasanguinis ATCC 15912]
 gi|296431759|gb|EFH17566.1| preprotein translocase [Streptococcus parasanguinis ATCC 15912]
          Length = 108

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                +  +  ++  + YF + R Q++Q Q+R E L  L++G+ ++T  G+ G +  V  
Sbjct: 1   MQGGSLLIMLVLMVGLMYF-MSRSQKKQYQKRMESLNKLQKGNEVITIGGLYGTIDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           + +  V   + V +      +  V   SE
Sbjct: 60  ERKTVVLDVDGVYLTFELGAIKTVLPVSE 88


>gi|261749510|ref|YP_003257196.1| preprotein translocase subunit YajC [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497603|gb|ACX84053.1| preprotein translocase, YajC subunit [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 109

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
              +F ++ +V+YF +IRPQ ++ +   +   N+++G+ IVT++GI GK++ V D   + 
Sbjct: 13  TLWMFALIFIVFYFFMIRPQIRKQKIEKKFQENIKKGNHIVTSSGIHGKIIEVTDHFYIL 72

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
             I    ++++ R+ +S+  +
Sbjct: 73  ETIVG--KIKLERNTISKELT 91


>gi|323706425|ref|ZP_08117987.1| preprotein translocase, YajC subunit [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534210|gb|EGB23999.1| preprotein translocase, YajC subunit [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 94

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 49/83 (59%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           + + G   +   ++YFLLI PQ+++ ++   M+  L+ GD I+T +GI GK++ + DD  
Sbjct: 6   IYLIGEIVIFMAIFYFLLILPQQRREKKEKAMIDALKPGDEILTKSGIYGKILNIKDDAI 65

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
                A+ V++++ +  V +V S
Sbjct: 66  TIEVGADKVKLKIAKWSVGKVLS 88


>gi|229086979|ref|ZP_04219136.1| hypothetical protein bcere0022_35520 [Bacillus cereus Rock3-44]
 gi|228696355|gb|EEL49183.1| hypothetical protein bcere0022_35520 [Bacillus cereus Rock3-44]
          Length = 86

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   L++GD+IVT  G+ G +  V +  
Sbjct: 4   GMMNIIMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELKKGDAIVTIGGLHGTIESVDETK 63

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
            +    +    +   R+ + EV  
Sbjct: 64  IVV--KSGGSHLTFDRNAIREVVK 85


>gi|329767258|ref|ZP_08258785.1| preprotein translocase subunit [Gemella haemolysans M341]
 gi|328836925|gb|EGF86572.1| preprotein translocase subunit [Gemella haemolysans M341]
          Length = 87

 Score = 79.4 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
                  +   L    YF++IRPQ ++ +    +  +L+ GD IVT AGI G +V V   
Sbjct: 3   GSYINIIMIVFLFGFMYFMIIRPQSKRNKELKLLQDSLKEGDRIVTFAGIYGDIVEV-GT 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSK 104
           + ++V IA  V + + R+ +  + +K
Sbjct: 62  VTVKVRIAPKVEIEIDRNAIRSLVAK 87


>gi|329114533|ref|ZP_08243292.1| Immunogenic membrane protein YajC [Acetobacter pomorum DM001]
 gi|326696013|gb|EGE47695.1| Immunogenic membrane protein YajC [Acetobacter pomorum DM001]
          Length = 121

 Score = 79.4 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 63/106 (59%), Gaps = 3/106 (2%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +    YAQS         S L     F  + V+ YFLLIRPQ++Q ++    L+ LRRGD
Sbjct: 6   LIPAAYAQSA--GGVGGGSSLMSFLPFVAVFVIMYFLLIRPQQKQQKQLKAELKALRRGD 63

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKS 105
            IVTA G+VG V R  DD  E+EVEIA NVRV VVRS +S V + +
Sbjct: 64  RIVTAGGVVGIVQRSKDDSEEVEVEIAPNVRVMVVRSTISRVLTST 109


>gi|228993155|ref|ZP_04153077.1| hypothetical protein bpmyx0001_38910 [Bacillus pseudomycoides DSM
           12442]
 gi|228766614|gb|EEM15255.1| hypothetical protein bpmyx0001_38910 [Bacillus pseudomycoides DSM
           12442]
          Length = 86

 Score = 79.4 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   +++GD+IVT  G+ G +  V DD 
Sbjct: 4   GMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSEIQKGDAIVTIGGLHGTIESV-DDT 62

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSK 104
            + ++ +    +   R+ + EV  K
Sbjct: 63  TIVIK-SGGSHLTFDRNAIREVVKK 86


>gi|297620450|ref|YP_003708587.1| putative preprotein translocase subunit YajC [Waddlia chondrophila
           WSU 86-1044]
 gi|297375751|gb|ADI37581.1| putative preprotein translocase subunit YajC [Waddlia chondrophila
           WSU 86-1044]
          Length = 131

 Score = 79.4 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 54/104 (51%), Gaps = 4/104 (3%)

Query: 3   TTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSI 62
           + ++AQ            L+   +  +    +YF+L RP++++ +   E   +L++GD +
Sbjct: 26  SALFAQDGGTRPEPG--MLQPIMMIAIAMAFFYFILWRPEQKRRKALEEQRSSLKKGDKV 83

Query: 63  VTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            T  GI+G + R   D  + +++ +  ++ V++  +++V S SE
Sbjct: 84  -TVMGIIGHIDRDQGD-TVILKMIDGNKIEVLKGAITDVVSASE 125


>gi|225572440|ref|ZP_03781304.1| hypothetical protein RUMHYD_00737 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040077|gb|EEG50323.1| hypothetical protein RUMHYD_00737 [Blautia hydrogenotrophica DSM
           10507]
          Length = 100

 Score = 79.4 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
              A     M     +L V+ YFL+IRPQ+++ +R   ML ++  GDS+VT +G  G ++
Sbjct: 3   SQGAMGVGGMIIWIVILFVIMYFLMIRPQKKEQKRVNAMLSSMEVGDSVVTTSGFYGVII 62

Query: 74  RVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            +  +D+ +E     N R+ + ++ ++EV+  S  V
Sbjct: 63  DLTEEDVIVEFGNNRNCRIPMRKAAIAEVEKASTSV 98


>gi|154250018|ref|YP_001410843.1| preprotein translocase, YajC subunit [Fervidobacterium nodosum
           Rt17-B1]
 gi|154153954|gb|ABS61186.1| preprotein translocase, YajC subunit [Fervidobacterium nodosum
           Rt17-B1]
          Length = 129

 Score = 79.4 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 52/80 (65%), Gaps = 1/80 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            ++M  +  +   + YFL+I PQR++ +   +M+ +L+RGD+I+T  GIVGK++ +  D 
Sbjct: 28  LMQMLIMLLIFFAMMYFLVILPQRRREKEFKQMVESLKRGDTIITTGGIVGKIIDIKKD- 86

Query: 80  ELEVEIAENVRVRVVRSFVS 99
            ++V+ A +  + + +++++
Sbjct: 87  TIKVKSANSTELEIHKAYIA 106


>gi|237751574|ref|ZP_04582054.1| preprotein translocase subunit YajC [Helicobacter bilis ATCC
          43879]
 gi|229372940|gb|EEO23331.1| preprotein translocase subunit YajC [Helicobacter bilis ATCC
          43879]
          Length = 110

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 51/79 (64%), Gaps = 2/79 (2%)

Query: 21 LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
          L       VL +V+YFL+ RPQ+QQ ++ A M+ +L+RGD IVT  G V +V++  DD  
Sbjct: 4  LISFLPLAVLILVFYFLVFRPQQQQRKKHAAMVESLKRGDKIVTNGGFVCEVIK-QDDRF 62

Query: 81 LEVEIAENVRVRVVRSFVS 99
          + VE+ +  +VR+ R FV+
Sbjct: 63 IVVELGD-TQVRLAREFVA 80


>gi|148652749|ref|YP_001279842.1| preprotein translocase, YajC subunit [Psychrobacter sp. PRwf-1]
 gi|148571833|gb|ABQ93892.1| protein translocase subunit yajC [Psychrobacter sp. PRwf-1]
          Length = 110

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +        +  ++YFL+IRPQ ++ +    M+ +L  G+ ++ A G++GK+  +  D 
Sbjct: 20  MIMQWIFPLAIFAIFYFLVIRPQSKRAKEHRNMVDSLAVGNEVIFAGGLMGKIKSIEGDY 79

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + V + +   V + R+ V  V     
Sbjct: 80  AV-VSLNDRNDVMIQRASVISVLPNGT 105


>gi|270290973|ref|ZP_06197196.1| preprotein translocase YajC subunit [Pediococcus acidilactici 7_4]
 gi|304385244|ref|ZP_07367589.1| translocase subunit [Pediococcus acidilactici DSM 20284]
 gi|270280369|gb|EFA26204.1| preprotein translocase YajC subunit [Pediococcus acidilactici 7_4]
 gi|304328451|gb|EFL95672.1| translocase subunit [Pediococcus acidilactici DSM 20284]
          Length = 127

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  +    +     F ++  + YF++IRPQR+Q Q+R EM+  L  GD +VT   + G V
Sbjct: 4   AAANGGFGMSTIVFFILIFGLMYFMMIRPQRKQQQKRQEMMNQLNVGDEVVTIGRLHGVV 63

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
             + ++ +      + + +   R  +  V+ K
Sbjct: 64  DSIDNEAKTVTLDCDGIYLVFDRMAIMRVEKK 95


>gi|333031440|ref|ZP_08459501.1| preprotein translocase, YajC subunit [Bacteroides coprosuis DSM
          18011]
 gi|332742037|gb|EGJ72519.1| preprotein translocase, YajC subunit [Bacteroides coprosuis DSM
          18011]
          Length = 104

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                S + M  +   + ++ YF +IRPQ ++ +  +   + L     ++TA GI G +
Sbjct: 9  QAAPGQSSMPMWIMLGAMFLIIYFFMIRPQNKKQKEISNFRKTLEVNQEVITAGGIYGTI 68

Query: 73 VRVIDDLELEVEIAENVRVRVVRSFV 98
           + I+   +E++IA  V++ +  + +
Sbjct: 69 -KHIEGQTVELQIANGVKILIDVNSI 93


>gi|298370065|ref|ZP_06981381.1| preprotein translocase, YajC subunit [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281525|gb|EFI23014.1| preprotein translocase, YajC subunit [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 88

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             S L       ++ VV+YFL++RPQ+++ +    ML +L+ GD ++  AG  GK+ +V 
Sbjct: 3   QGSMLTQFAPLILIMVVFYFLIMRPQQKKFKAHQAMLADLKVGDKVLLTAGFKGKITKVG 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSE 100
           +     VEI   V V V R+ ++ 
Sbjct: 63  EQFF-TVEIGRGVDVEVERNAIAA 85


>gi|302874953|ref|YP_003843586.1| preprotein translocase, YajC subunit [Clostridium cellulovorans
           743B]
 gi|307690429|ref|ZP_07632875.1| preprotein translocase subunit YajC [Clostridium cellulovorans
           743B]
 gi|302577810|gb|ADL51822.1| preprotein translocase, YajC subunit [Clostridium cellulovorans
           743B]
          Length = 99

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 53/88 (60%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             S +     F  +  ++YFLLIRP++++ ++  +++ NL+  D IVT  GIVGKV+ + 
Sbjct: 1   MASYIPTIAYFAFMIAIFYFLLIRPEKKRKKQFQDLMGNLKVNDEIVTKGGIVGKVITIE 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSK 104
           +D  +     E  R+R+++S + E+ SK
Sbjct: 61  NDNLIIQSGPEKTRIRILKSAILEISSK 88


>gi|149921271|ref|ZP_01909727.1| preprotein translocase YajC subunit [Plesiocystis pacifica SIR-1]
 gi|149817931|gb|EDM77393.1| preprotein translocase YajC subunit [Plesiocystis pacifica SIR-1]
          Length = 128

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 52/78 (66%), Gaps = 1/78 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
                 ++  V+YFL++RP ++Q + R + L  L+RGD +V + GI+G+V +V +D  + 
Sbjct: 5   PMVPVILMFAVFYFLVMRPMKKQEEERKQRLSELKRGDKVVLSGGILGRVSKV-EDDIVL 63

Query: 83  VEIAENVRVRVVRSFVSE 100
           +E+A+ V++RV++  VS+
Sbjct: 64  IEVADKVKLRVLKKEVSD 81


>gi|253578126|ref|ZP_04855398.1| preprotein translocase subunit [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850444|gb|EES78402.1| preprotein translocase subunit [Ruminococcus sp. 5_1_39BFAA]
          Length = 99

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
            +S    +       VL  + YFL++RPQ+++ +R   ML ++  GDSIVT  G  G V+
Sbjct: 3   ASSGMGMVGAIVWMVVLFGIMYFLMLRPQKKEQKRLQAMLNDMEVGDSIVTTGGFYGVVI 62

Query: 74  RVI-DDLELEVEIAENVRVRVVRSFVSEVQSKS 105
            +  +D+ +E    +N R+ + +  ++EV+   
Sbjct: 63  DMTEEDVIVEFGNNKNCRIPMRKQAIAEVEKAG 95


>gi|196039196|ref|ZP_03106502.1| preprotein translocase, YajC subunit [Bacillus cereus NVH0597-99]
 gi|222097861|ref|YP_002531918.1| preprotein translocase subunit yajc [Bacillus cereus Q1]
 gi|229093487|ref|ZP_04224590.1| hypothetical protein bcere0021_42110 [Bacillus cereus Rock3-42]
 gi|196029823|gb|EDX68424.1| preprotein translocase, YajC subunit [Bacillus cereus NVH0597-99]
 gi|221241919|gb|ACM14629.1| preprotein translocase, YajC subunit [Bacillus cereus Q1]
 gi|228689958|gb|EEL43762.1| hypothetical protein bcere0021_42110 [Bacillus cereus Rock3-42]
          Length = 86

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   L++GD+IVT  G+ G +  V +  
Sbjct: 4   GMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELKKGDAIVTIGGLHGTIESVDETK 63

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
            +    +    +   R+ + EV  
Sbjct: 64  IVV--KSGGSHLTFDRNAIREVVK 85


>gi|322376163|ref|ZP_08050671.1| preprotein translocase, YajC subunit [Streptococcus sp. C300]
 gi|321278845|gb|EFX55890.1| preprotein translocase, YajC subunit [Streptococcus sp. C300]
          Length = 106

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 1/90 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S      +   +  +  F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  +
Sbjct: 3   SQYTFLIMLVGMFALM-FFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTE 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
               V   + V +    + +  V    E V
Sbjct: 62  KGTIVLDVDGVYLTFELAAIKTVLPLKEAV 91


>gi|328957020|ref|YP_004374406.1| preprotein translocase subunit YajC [Carnobacterium sp. 17-4]
 gi|328673344|gb|AEB29390.1| preprotein translocase subunit YajC [Carnobacterium sp. 17-4]
          Length = 101

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 31  AVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVR 90
             + YF++IRPQ++   +   ML  +++GDSIVT  G+ G +  V       V   + + 
Sbjct: 1   MGLMYFMMIRPQKKAATKTQNMLDAMKKGDSIVTIGGLHGIIDEVNTTNNTVVLDCDGIF 60

Query: 91  VRVVRSFVSEVQSKS--EPV 108
           +   +  ++ + +     P+
Sbjct: 61  LTFEKKAIARIVTTGVSTPI 80


>gi|237808774|ref|YP_002893214.1| preprotein translocase, YajC subunit [Tolumonas auensis DSM 9187]
 gi|237501035|gb|ACQ93628.1| preprotein translocase, YajC subunit [Tolumonas auensis DSM 9187]
          Length = 112

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/107 (21%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +    YA +D  A +S T  +E   +  +  + +YF + RPQ ++ + +  ++ +L +GD
Sbjct: 3   LLAKAYA-ADGGAASSVTGGIEQIAIVGIFLLFFYFFIFRPQSKRAKEQKNLMSSLGKGD 61

Query: 61  SIVTAAGIVGKVVRVI-DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            ++T+ G+VGK+ ++  D   + + + +   + + + +++ V  K  
Sbjct: 62  EVLTSGGLVGKIAKISADSDYIVLALNDQTSITIKKDYITAVLPKGT 108


>gi|284041155|ref|YP_003391085.1| preprotein translocase, YajC subunit [Spirosoma linguale DSM 74]
 gi|283820448|gb|ADB42286.1| preprotein translocase, YajC subunit [Spirosoma linguale DSM 74]
          Length = 108

 Score = 79.0 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
             A  S TS +    L+  +  V+YF +IRPQ+++ + +   + NL++GDS+VT  G+ G
Sbjct: 7   QAAAGSNTSMIYNVLLWVAIIGVFYFFMIRPQQKKQKDQKSFVDNLKKGDSVVTIGGLHG 66

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           ++  V D   + +E+   +++   +S +S 
Sbjct: 67  RIASV-DATTVTLEVDRGIKMTFEKSSISR 95


>gi|42783547|ref|NP_980794.1| preprotein translocase subunit YajC [Bacillus cereus ATCC 10987]
 gi|206975932|ref|ZP_03236842.1| preprotein translocase, YajC subunit [Bacillus cereus H3081.97]
 gi|217961907|ref|YP_002340477.1| preprotein translocase subunit YajC [Bacillus cereus AH187]
 gi|229141155|ref|ZP_04269696.1| hypothetical protein bcere0013_42480 [Bacillus cereus BDRD-ST26]
 gi|229198544|ref|ZP_04325247.1| hypothetical protein bcere0001_40710 [Bacillus cereus m1293]
 gi|42739476|gb|AAS43402.1| preprotein translocase, YajC subunit [Bacillus cereus ATCC 10987]
 gi|206745684|gb|EDZ57081.1| preprotein translocase, YajC subunit [Bacillus cereus H3081.97]
 gi|217067930|gb|ACJ82180.1| preprotein translocase, YajC subunit [Bacillus cereus AH187]
 gi|228584929|gb|EEK43044.1| hypothetical protein bcere0001_40710 [Bacillus cereus m1293]
 gi|228642318|gb|EEK98608.1| hypothetical protein bcere0013_42480 [Bacillus cereus BDRD-ST26]
 gi|324328319|gb|ADY23579.1| preprotein translocase subunit YajC [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 86

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   L++GD+IVT  G+ G +  V +  
Sbjct: 4   GMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELKKGDAIVTIGGLHGTIESVDETK 63

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
            +    +    +   R+ + EV  
Sbjct: 64  IVI--KSGGSHLTFDRNAIREVVK 85


>gi|325858410|ref|ZP_08172572.1| preprotein translocase, YajC subunit [Prevotella denticola CRIS
          18C-A]
 gi|327313922|ref|YP_004329359.1| preprotein translocase subunit YajC [Prevotella denticola F0289]
 gi|325483048|gb|EGC86036.1| preprotein translocase, YajC subunit [Prevotella denticola CRIS
          18C-A]
 gi|326945823|gb|AEA21708.1| preprotein translocase, YajC subunit [Prevotella denticola F0289]
          Length = 90

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 23 MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI-DDLEL 81
          M  +   +  + +FL+IRPQ+++ +        L  GD++VT  GI G V  +     ++
Sbjct: 1  MIIMMVAIFAIMWFLMIRPQQKKQKEIRAFQNALSAGDTVVTGGGIYGTVKHIDMTTNKV 60

Query: 82 EVEIAENVRVRVVRSFV 98
          +VEIA  V + V +S+V
Sbjct: 61 DVEIARGVVITVDKSYV 77


>gi|325285043|ref|YP_004260833.1| preprotein translocase, YajC subunit [Cellulophaga lytica DSM 7489]
 gi|324320497|gb|ADY27962.1| preprotein translocase, YajC subunit [Cellulophaga lytica DSM 7489]
          Length = 100

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
                  + +V YF +IRPQ ++ +   +    L++GD ++T +G+ GK+  + D     
Sbjct: 9   PFLPMVGIFIVAYFFMIRPQMKRSKDEKKFAEQLKKGDKVITKSGMHGKIFDLNDKDMSC 68

Query: 83  VEIAENVRVRVVRSFVSEVQSK--SEPV 108
           V      +++  RS +S   SK  +EPV
Sbjct: 69  VIETMAGKIKFSRSAISMEMSKKLNEPV 96


>gi|229827976|ref|ZP_04454045.1| hypothetical protein GCWU000342_00024 [Shuttleworthia satelles DSM
           14600]
 gi|229792570|gb|EEP28684.1| hypothetical protein GCWU000342_00024 [Shuttleworthia satelles DSM
           14600]
          Length = 121

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 46/73 (63%), Gaps = 3/73 (4%)

Query: 31  AVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE--IAEN 88
               YF++IRPQ+++ +++  ML +L  GD+++T +G  G V+ + ++  + VE    +N
Sbjct: 19  FAFMYFMMIRPQQKEQKQKTAMLSSLAVGDTVMTTSGFYGVVIDIDEE-TVIVEFGSNKN 77

Query: 89  VRVRVVRSFVSEV 101
            R+ + +S +S+V
Sbjct: 78  CRIPMSKSAISQV 90


>gi|229032067|ref|ZP_04188049.1| hypothetical protein bcere0028_41110 [Bacillus cereus AH1271]
 gi|228729259|gb|EEL80254.1| hypothetical protein bcere0028_41110 [Bacillus cereus AH1271]
          Length = 86

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   L +GD+IVT  G+ G +  V DD 
Sbjct: 4   GMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELSKGDAIVTIGGLHGTIESV-DDT 62

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
           ++ ++ +    +   R+ + EV  
Sbjct: 63  KIVIK-SGGSHLTFDRNAIREVVK 85


>gi|218132977|ref|ZP_03461781.1| hypothetical protein BACPEC_00838 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991850|gb|EEC57854.1| hypothetical protein BACPEC_00838 [Bacteroides pectinophilus ATCC
           43243]
          Length = 99

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 15  TSATSPLEMAGLFFVLA-VVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             A S + M  ++ V    + YF+ IRPQ++Q ++  E++ +L  GD ++T +G  G ++
Sbjct: 6   AGAGSTVGMILVYVVFLGALMYFMAIRPQKKQQKKMDELIASLEIGDYVLTTSGFYGSII 65

Query: 74  RVIDDL-ELEVEIAENVRVRVVRSFVSEV 101
            + DD   +E    +N R+ + +S +++V
Sbjct: 66  DITDDTVIVEFGNNKNCRIPMQKSAITQV 94


>gi|331090847|ref|ZP_08339693.1| preprotein translocase subunit [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330399706|gb|EGG79368.1| preprotein translocase subunit [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 90

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            L +  ++ V+   ++FLL+RPQ+++ +R   ML  L  GD+++T +G  G V+ V +D 
Sbjct: 1   MLSIIIVYAVILGGFWFLLMRPQKKEQKRIKLMLSELEVGDTVLTTSGFYGVVIDVQEDD 60

Query: 80  ELE-VEIAENVRVRVVRSFVSEVQSKSE 106
            +      +N R+ + ++ +S+V+    
Sbjct: 61  VVVEFGNNKNCRIPMQKAAISQVEKPGT 88


>gi|320103198|ref|YP_004178789.1| preprotein translocase subunit YajC [Isosphaera pallida ATCC 43644]
 gi|319750480|gb|ADV62240.1| preprotein translocase, YajC subunit [Isosphaera pallida ATCC
           43644]
          Length = 135

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 53/107 (49%), Gaps = 5/107 (4%)

Query: 1   MFTTVY--AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRR 58
           MF   +           + +S L     + ++ V++Y L+I PQR+Q + R   L  L++
Sbjct: 1   MFGLGFGLILVAQQQPAATSSLLTFMIPWLLVMVLFYALIIAPQRRQEKERLAQLAALKK 60

Query: 59  GDSIVTAAGIVGKVVRV-IDDLELEVEIAENVRVR--VVRSFVSEVQ 102
            D ++T  GI G VV     + ++ +++ +  +++    R+ +++V 
Sbjct: 61  NDKVLTVGGIYGTVVSAPAGEDKIVLKLDDEGKIKVSFSRASIAKVL 107


>gi|228999205|ref|ZP_04158786.1| hypothetical protein bmyco0003_37610 [Bacillus mycoides Rock3-17]
 gi|229006752|ref|ZP_04164386.1| hypothetical protein bmyco0002_36540 [Bacillus mycoides Rock1-4]
 gi|228754613|gb|EEM04024.1| hypothetical protein bmyco0002_36540 [Bacillus mycoides Rock1-4]
 gi|228760550|gb|EEM09515.1| hypothetical protein bmyco0003_37610 [Bacillus mycoides Rock3-17]
          Length = 86

 Score = 78.6 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   +++GD+IVT  G+ G +  V DD 
Sbjct: 4   GMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSGIQKGDAIVTIGGLHGTIESV-DDT 62

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSK 104
            + ++ +    +   R+ + EV  K
Sbjct: 63  TIVIK-SGGSHLTFDRNAIREVVKK 86


>gi|237752083|ref|ZP_04582563.1| preprotein translocase subunit YajC [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376650|gb|EEO26741.1| preprotein translocase subunit YajC [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 90

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           A +         VL  ++YFL+IRPQ+ Q +R  EM+ NL +GD +VT+ G + ++V+  
Sbjct: 4   AGNIFTQLLPLIVLIAIFYFLIIRPQQTQAKRHREMIANLDKGDKVVTSGGFIVEIVK-K 62

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQ 102
           ++    V + ++  V++ + +V++  
Sbjct: 63  EEEFFMVRLNDDTLVKLSKDYVAKKI 88


>gi|299139863|ref|ZP_07033035.1| preprotein translocase, YajC subunit [Acidobacterium sp. MP5ACTX8]
 gi|298598217|gb|EFI54383.1| preprotein translocase, YajC subunit [Acidobacterium sp. MP5ACTX8]
          Length = 105

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 45/82 (54%)

Query: 25  GLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVE 84
            L  ++ V  Y LLI P +++ ++   ML  L+ GD + T  G+ G VV V DD+ +   
Sbjct: 21  PLLVIMFVAMYLLLIVPNQRKQKQWQSMLAQLKPGDKVTTNGGMRGTVVNVKDDVLVIRT 80

Query: 85  IAENVRVRVVRSFVSEVQSKSE 106
             + V+  +VRS ++ V ++ E
Sbjct: 81  QPDGVKFEIVRSAIAAVTAEEE 102


>gi|262068278|ref|ZP_06027890.1| preprotein translocase, YajC subunit [Fusobacterium periodonticum
          ATCC 33693]
 gi|291378016|gb|EFE85534.1| preprotein translocase, YajC subunit [Fusobacterium periodonticum
          ATCC 33693]
          Length = 95

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 22 EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
             GL  +   V+YFLLIRP +++ + +  +L +L+ G  ++T  GI G +  V +D  +
Sbjct: 10 STIGLVVLWIGVFYFLLIRPNKKRQKEQQNLLNSLKEGTEVITIGGIKGTIAFVGED-YV 68

Query: 82 EVEIAENVRVRVVRS 96
          E+ + + V++   +S
Sbjct: 69 ELRVDKGVKLTFRKS 83


>gi|229163364|ref|ZP_04291316.1| hypothetical protein bcere0009_41300 [Bacillus cereus R309803]
 gi|228620145|gb|EEK77019.1| hypothetical protein bcere0009_41300 [Bacillus cereus R309803]
          Length = 86

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + +    +   +  ++YFLLIRPQ+++ +  A+M   L++GD+IVT  G+ G +  V + 
Sbjct: 3   AGMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELKKGDAIVTIGGLHGTIESVDET 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQS 103
             +    +    +   R+ + EV  
Sbjct: 63  KIVV--KSGGSHLTFDRNAIREVVK 85


>gi|315611926|ref|ZP_07886844.1| preprotein translocase [Streptococcus sanguinis ATCC 49296]
 gi|331265596|ref|YP_004325226.1| preprotein translocase subunit YajC [Streptococcus oralis Uo5]
 gi|315315915|gb|EFU63949.1| preprotein translocase [Streptococcus sanguinis ATCC 49296]
 gi|326682268|emb|CBY99885.1| preprotein translocase subunit YajC [Streptococcus oralis Uo5]
          Length = 109

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 1/88 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +   +  +  F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  +  
Sbjct: 8   LTFLIMLVGMFALM-FFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKG 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEPV 108
             V   + V +    + +  V    E V
Sbjct: 67  TIVLDVDGVYLTFELAAIKTVLPLKEAV 94


>gi|189219948|ref|YP_001940588.1| preprotein translocase subunit YajC [Methylacidiphilum infernorum
           V4]
 gi|189186806|gb|ACD83991.1| Preprotein translocase subunit YajC [Methylacidiphilum infernorum
           V4]
          Length = 137

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
           A        P+       ++  ++YFLLIRPQ++Q + + +++ +L  GD ++T+ GI+G
Sbjct: 26  AQQAPEGPPPMTFFITTILIFGIFYFLLIRPQQKQKKEQEKLIASLETGDRVITSGGILG 85

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS--KSEP 107
            V  V +   + + +AENV++ V++S ++ V    K EP
Sbjct: 86  VVTNVKE-KTVVIRVAENVKIEVLKSALTTVTKTVKEEP 123


>gi|319945657|ref|ZP_08019909.1| preprotein translocase [Streptococcus australis ATCC 700641]
 gi|319748256|gb|EFW00498.1| preprotein translocase [Streptococcus australis ATCC 700641]
          Length = 109

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 38/87 (43%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
                   L V   F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  + + 
Sbjct: 5   TTLLFMLALMVGMMFFMSRSQKKQYQKRMESLNKLQKGYEVITIGGLYGTVDEVDTERKT 64

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEPV 108
            V   + V +    + +  V   SE V
Sbjct: 65  VVLDVDGVYLTFELTAIKTVLPVSEGV 91


>gi|313157953|gb|EFR57359.1| preprotein translocase, YajC subunit [Alistipes sp. HGB5]
          Length = 106

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
                        +  ++ +V +  + RP+ ++ ++       L++GD ++TA GI G V
Sbjct: 12  PQPGFMQQYSFIIMIGLMVLVLWLFMWRPEAKRRKQMQAFRDGLKKGDKVITAGGIYGTV 71

Query: 73  VRVIDDLELEVEIAENVRVRVVRSFVSE 100
             + +   L +E+  NV +R+ ++ V  
Sbjct: 72  KEIKE-TTLLIEVDGNVTLRIDKNMVVA 98


>gi|116670847|ref|YP_831780.1| protein translocase subunit yajC [Arthrobacter sp. FB24]
 gi|116610956|gb|ABK03680.1| protein translocase subunit yajC [Arthrobacter sp. FB24]
          Length = 149

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 54/109 (49%), Gaps = 7/109 (6%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF  + AQ+   A         M  L FV+  ++ F++ R  ++  Q++A +      G 
Sbjct: 1   MFGHITAQTQPQAGGGID---IMTILLFVMLGLFIFMMFRRNKKTQQQQASLQSQFAPGV 57

Query: 61  SIVTAAGIVGKVVRVIDD-LELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            ++T+ G+ G++V + +D  ++ +E++      V R  V+++    EPV
Sbjct: 58  EVMTSFGLYGRIVSIDEDENKVVIELSPGNLATVHRQAVTKIV---EPV 103


>gi|254518555|ref|ZP_05130611.1| preprotein translocase subunit YajC [Clostridium sp. 7_2_43FAA]
 gi|226912304|gb|EEH97505.1| preprotein translocase subunit YajC [Clostridium sp. 7_2_43FAA]
          Length = 91

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 50/86 (58%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L +   F ++  + YFLLI P++++ ++  EML  L + D IVT  GI+GK++ V ++  
Sbjct: 5   LSLVVPFVLMFGLMYFLLILPEKKRTKKYNEMLSALEKNDEIVTRGGIMGKIIIVEENYV 64

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
           +    AE  ++++ ++ ++   +K  
Sbjct: 65  IIETSAERTKLKISKNGIASKVNKVT 90


>gi|317010233|gb|ADU80813.1| preprotein translocase subunit YajC [Helicobacter pylori India7]
          Length = 127

 Score = 78.6 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 15 TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                L     F VL +++YFL++RPQRQQ ++  EM+  L +GD IVT  G++ +V++
Sbjct: 2  GQTKEILTTLLPFVVLFLIFYFLIVRPQRQQQKKHKEMIEGLAKGDKIVTQGGLIVEVLK 61

Query: 75 VIDDLELEVEIAENVRVRVVRSFVS 99
            +     V++ ++   ++ +++++
Sbjct: 62 A-EANFFSVKLNDDTTAKLSKNYIA 85


>gi|307707723|ref|ZP_07644202.1| preprotein translocase, YajC subunit [Streptococcus mitis NCTC
           12261]
 gi|307616221|gb|EFN95415.1| preprotein translocase, YajC subunit [Streptococcus mitis NCTC
           12261]
          Length = 99

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                +   +  +  F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  +  
Sbjct: 5   YTFLIMLVAMLGLM-FFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKR 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
             V   + V +    + +  V  
Sbjct: 64  TIVLDVDGVYLTFELAAIKTVLP 86


>gi|229019639|ref|ZP_04176450.1| hypothetical protein bcere0030_41410 [Bacillus cereus AH1273]
 gi|229025878|ref|ZP_04182274.1| hypothetical protein bcere0029_41690 [Bacillus cereus AH1272]
 gi|228735430|gb|EEL86029.1| hypothetical protein bcere0029_41690 [Bacillus cereus AH1272]
 gi|228741663|gb|EEL91852.1| hypothetical protein bcere0030_41410 [Bacillus cereus AH1273]
          Length = 86

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   L +GD+I+T  G+ G +  V +  
Sbjct: 4   GMMNIIMIVAMFAIFYFLLIRPQQKRQKAVAQMQNELSKGDAIITIGGLHGTIESVDETK 63

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
            +    +    +   R+ + EV  
Sbjct: 64  IVV--KSGGSHLTFDRNAIREVVK 85


>gi|164687533|ref|ZP_02211561.1| hypothetical protein CLOBAR_01174 [Clostridium bartlettii DSM
           16795]
 gi|164603307|gb|EDQ96772.1| hypothetical protein CLOBAR_01174 [Clostridium bartlettii DSM
           16795]
          Length = 93

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 45/88 (51%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           S +        L  ++YFL IRPQ+++ +   EM  +L  GD+IVT  GIV  V ++ ++
Sbjct: 4   SLIWSIAYIVALFAIFYFLFIRPQKKKDKELKEMRDSLAVGDTIVTIGGIVANVAKIEEE 63

Query: 79  LELEVEIAENVRVRVVRSFVSEVQSKSE 106
             +        ++ + +  +  VQSK E
Sbjct: 64  TIVIEFGPSRTKMPIQKWAIGSVQSKKE 91


>gi|32473218|ref|NP_866212.1| preprotein translocase subunit yajC [Rhodopirellula baltica SH 1]
 gi|32397897|emb|CAD73898.1| conserved hypothetical protein-putative preprotein translocase
           subunit yajC [Rhodopirellula baltica SH 1]
          Length = 139

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 55/111 (49%), Gaps = 8/111 (7%)

Query: 5   VYAQSDAPAITSATSPLEM---AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           + AQ  APA  S+     +     L   +  ++Y     P+R++    A+M+ ++ + D 
Sbjct: 23  LLAQDAAPAGESSILQRILENPLILPVGVVAIFYVTYFGPERRRRAEEAKMMSSMAKNDR 82

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAEN--VRVRVVRSFVSEVQ--SKSEP 107
           +VT  GI G +V    D   + ++I EN   R++V RS + ++    K++P
Sbjct: 83  VVTIGGIHGTIVSAAPDSETVTLKIDENGSTRIKVNRSAIVKIVGEPKNKP 133


>gi|30264486|ref|NP_846863.1| preprotein translocase subunit YajC [Bacillus anthracis str. Ames]
 gi|47529944|ref|YP_021293.1| preprotein translocase subunit YajC [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49187306|ref|YP_030558.1| preprotein translocase subunit YajC [Bacillus anthracis str.
           Sterne]
 gi|49481500|ref|YP_038466.1| preprotein translocase subunit YajC [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|65321782|ref|ZP_00394741.1| COG1862: Preprotein translocase subunit YajC [Bacillus anthracis
           str. A2012]
 gi|118479572|ref|YP_896723.1| preprotein translocase subunit YajC [Bacillus thuringiensis str. Al
           Hakam]
 gi|165872022|ref|ZP_02216663.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0488]
 gi|167640698|ref|ZP_02398958.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0193]
 gi|170688691|ref|ZP_02879896.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0465]
 gi|170709256|ref|ZP_02899676.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0389]
 gi|177653953|ref|ZP_02935994.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0174]
 gi|190566832|ref|ZP_03019748.1| preprotein translocase, YajC subunit [Bacillus anthracis
           Tsiankovskii-I]
 gi|196034332|ref|ZP_03101741.1| preprotein translocase, YajC subunit [Bacillus cereus W]
 gi|196044839|ref|ZP_03112073.1| preprotein translocase, YajC subunit [Bacillus cereus 03BB108]
 gi|218905611|ref|YP_002453445.1| preprotein translocase, YajC subunit [Bacillus cereus AH820]
 gi|225866397|ref|YP_002751775.1| preprotein translocase, YajC subunit [Bacillus cereus 03BB102]
 gi|227817194|ref|YP_002817203.1| preprotein translocase, YajC subunit [Bacillus anthracis str. CDC
           684]
 gi|228917052|ref|ZP_04080612.1| hypothetical protein bthur0012_42640 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228929461|ref|ZP_04092482.1| hypothetical protein bthur0010_41460 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228935736|ref|ZP_04098549.1| hypothetical protein bthur0009_41810 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228948130|ref|ZP_04110414.1| hypothetical protein bthur0007_42560 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229123957|ref|ZP_04253149.1| hypothetical protein bcere0016_42420 [Bacillus cereus 95/8201]
 gi|229186655|ref|ZP_04313816.1| hypothetical protein bcere0004_41980 [Bacillus cereus BGSC 6E1]
 gi|229603753|ref|YP_002868702.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0248]
 gi|254684171|ref|ZP_05148031.1| preprotein translocase subunit YajC [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724658|ref|ZP_05186441.1| preprotein translocase subunit YajC [Bacillus anthracis str. A1055]
 gi|254736518|ref|ZP_05194224.1| preprotein translocase subunit YajC [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741556|ref|ZP_05199243.1| preprotein translocase subunit YajC [Bacillus anthracis str. Kruger
           B]
 gi|254751345|ref|ZP_05203382.1| preprotein translocase subunit YajC [Bacillus anthracis str.
           Vollum]
 gi|254757677|ref|ZP_05209704.1| preprotein translocase subunit YajC [Bacillus anthracis str.
           Australia 94]
 gi|301055924|ref|YP_003794135.1| preprotein translocase subunit YajC [Bacillus anthracis CI]
 gi|30259144|gb|AAP28349.1| preprotein translocase, YajC subunit [Bacillus anthracis str. Ames]
 gi|47505092|gb|AAT33768.1| preprotein translocase, YajC subunit [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49181233|gb|AAT56609.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           Sterne]
 gi|49333056|gb|AAT63702.1| preprotein translocase, subunit YajC [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|118418797|gb|ABK87216.1| protein translocase subunit yajC [Bacillus thuringiensis str. Al
           Hakam]
 gi|164712312|gb|EDR17848.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0488]
 gi|167511270|gb|EDR86656.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0193]
 gi|170125832|gb|EDS94739.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0389]
 gi|170667377|gb|EDT18135.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0465]
 gi|172081008|gb|EDT66086.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0174]
 gi|190561823|gb|EDV15792.1| preprotein translocase, YajC subunit [Bacillus anthracis
           Tsiankovskii-I]
 gi|195992874|gb|EDX56833.1| preprotein translocase, YajC subunit [Bacillus cereus W]
 gi|196024327|gb|EDX63000.1| preprotein translocase, YajC subunit [Bacillus cereus 03BB108]
 gi|218538704|gb|ACK91102.1| preprotein translocase, YajC subunit [Bacillus cereus AH820]
 gi|225786794|gb|ACO27011.1| preprotein translocase, YajC subunit [Bacillus cereus 03BB102]
 gi|227007165|gb|ACP16908.1| preprotein translocase, YajC subunit [Bacillus anthracis str. CDC
           684]
 gi|228596914|gb|EEK54573.1| hypothetical protein bcere0004_41980 [Bacillus cereus BGSC 6E1]
 gi|228659259|gb|EEL14907.1| hypothetical protein bcere0016_42420 [Bacillus cereus 95/8201]
 gi|228811488|gb|EEM57825.1| hypothetical protein bthur0007_42560 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228823974|gb|EEM69793.1| hypothetical protein bthur0009_41810 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228830249|gb|EEM75865.1| hypothetical protein bthur0010_41460 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228842659|gb|EEM87747.1| hypothetical protein bthur0012_42640 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|229268161|gb|ACQ49798.1| preprotein translocase, YajC subunit [Bacillus anthracis str.
           A0248]
 gi|300378093|gb|ADK06997.1| preprotein translocase, YajC subunit [Bacillus cereus biovar
           anthracis str. CI]
          Length = 86

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + +    +   +  ++YFLLIRPQ+++ +  A+M   L++GD+IVT  G+ G +  V + 
Sbjct: 3   AGMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELKKGDAIVTIGGLHGTIESVDET 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQS 103
             +    +    +   R+ + EV  
Sbjct: 63  KIVI--KSGGSHLTFDRNAIREVVK 85


>gi|317502726|ref|ZP_07960837.1| preprotein translocase [Prevotella salivae DSM 15606]
 gi|315666170|gb|EFV05726.1| preprotein translocase [Prevotella salivae DSM 15606]
          Length = 105

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 12 PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
           A  +    + +  +   + ++++  ++RPQ+++ ++      +L+ G  +VT  GI G 
Sbjct: 7  SAQAAQGGGMGVFVMMGAILIIFWLFMVRPQQKKQKKIRNFQNSLQEGSKVVTGGGIYGT 66

Query: 72 VVRVI-DDLELEVEIAENVRVRVVRSFV 98
          + RV      ++VEIA  V + V + +V
Sbjct: 67 IKRVDIQANTVDVEIARGVVITVNKGYV 94


>gi|160881561|ref|YP_001560529.1| preprotein translocase, YajC subunit [Clostridium phytofermentans
           ISDg]
 gi|160430227|gb|ABX43790.1| preprotein translocase, YajC subunit [Clostridium phytofermentans
           ISDg]
          Length = 110

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/98 (33%), Positives = 57/98 (58%), Gaps = 1/98 (1%)

Query: 9   SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGI 68
           +DA A   A S   M G   V+  ++YF+ IRPQ++Q ++   ++ +L  GDS++T +G 
Sbjct: 8   ADAAATGGAMSWTWMIGYIIVIGGIFYFMAIRPQKKQQKQMNALISSLEIGDSVLTTSGF 67

Query: 69  VGKVVRVIDDL-ELEVEIAENVRVRVVRSFVSEVQSKS 105
            G V+ V+DD+  +E    +N R+ + +S V EV+   
Sbjct: 68  YGVVIDVMDDVIIVEFGNNKNCRIPMKKSAVVEVEKPG 105


>gi|86143183|ref|ZP_01061585.1| preprotein translocase, YajC subunit [Leeuwenhoekiella blandensis
           MED217]
 gi|85830088|gb|EAQ48548.1| preprotein translocase, YajC subunit [Leeuwenhoekiella blandensis
           MED217]
          Length = 97

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       ++  V Y  +IRPQ ++ +   +    L+RGD ++T +G+ GK++ + +D  
Sbjct: 4   ITSFLPILLMIAVVYLFMIRPQMKRQKEEKKFAEELKRGDRVITKSGLHGKILDL-NDTT 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQSK 104
           + +E     +++  R+ +S   +K
Sbjct: 63  VILESGAG-KMKFERTALSLELTK 85


>gi|306830227|ref|ZP_07463410.1| preprotein translocase [Streptococcus mitis ATCC 6249]
 gi|304427594|gb|EFM30691.1| preprotein translocase [Streptococcus mitis ATCC 6249]
          Length = 109

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 1/88 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +   +  +  F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  +  
Sbjct: 8   LTFVIMLVGMFALM-FFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKR 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEPV 108
             V   + V +    + +  V    E V
Sbjct: 67  TIVLDVDGVYLTFELAAIKTVLPLKEAV 94


>gi|320547757|ref|ZP_08042041.1| preprotein translocase [Streptococcus equinus ATCC 9812]
 gi|320447517|gb|EFW88276.1| preprotein translocase [Streptococcus equinus ATCC 9812]
          Length = 114

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +    +  V+  + +F + R Q++Q Q R E L+ L++GD IVT  G+ G +  V  D +
Sbjct: 1   MPTLIMLIVMVALIWF-MQRSQKKQAQNRQEQLKALQKGDEIVTIGGLYGIIDEVDVDNQ 59

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEP 107
             V   + V +      V  V +K++P
Sbjct: 60  KMVLDIDGVYLTFELGAVKRVVNKAQP 86


>gi|229175090|ref|ZP_04302607.1| hypothetical protein bcere0006_41710 [Bacillus cereus MM3]
 gi|228608386|gb|EEK65691.1| hypothetical protein bcere0006_41710 [Bacillus cereus MM3]
          Length = 86

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   L +GD+IVT  G+ G +  V +  
Sbjct: 4   GMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQNELAKGDAIVTIGGLHGTIESVDETK 63

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
            +    +    +   R+ + EV  
Sbjct: 64  IVI--KSGGSHLTFDRNAIREVVK 85


>gi|270293441|ref|ZP_06199649.1| preprotein translocase, YajC subunit [Streptococcus sp. M143]
 gi|270278103|gb|EFA23952.1| preprotein translocase, YajC subunit [Streptococcus sp. M143]
          Length = 106

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 39/91 (42%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P     +  V  +   F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPNITFLIMLVAMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDT 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +    V   + V +    + +  V    E V
Sbjct: 61  EKRTIVLDVDGVYLTFELAAIKTVLPLKEAV 91


>gi|257453224|ref|ZP_05618523.1| preprotein translocase subunit YajC [Fusobacterium sp. 3_1_5R]
 gi|257467186|ref|ZP_05631497.1| preprotein translocase subunit YajC [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|315918316|ref|ZP_07914556.1| translocase subunit YajC [Fusobacterium gonidiaformans ATCC 25563]
 gi|317059758|ref|ZP_07924243.1| translocase subunit YajC [Fusobacterium sp. 3_1_5R]
 gi|313685434|gb|EFS22269.1| translocase subunit YajC [Fusobacterium sp. 3_1_5R]
 gi|313692191|gb|EFS29026.1| translocase subunit YajC [Fusobacterium gonidiaformans ATCC 25563]
          Length = 86

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           +  +  V   ++YFL++RP +++ + + E+  +L  G  +VTA GI G ++ V +D  ++
Sbjct: 7   LILIVLVWGAIFYFLVMRPNKKRQKEQKELFDSLHEGVEVVTAGGIKGTILYVGEDF-VD 65

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
           V++ + V++ V ++ +S +  
Sbjct: 66  VKVDKGVKLTVRKTSISTIVK 86


>gi|241889854|ref|ZP_04777152.1| preprotein translocase, YajC subunit [Gemella haemolysans ATCC
           10379]
 gi|241863476|gb|EER67860.1| preprotein translocase, YajC subunit [Gemella haemolysans ATCC
           10379]
          Length = 87

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
                 +  VL    YF++IRPQ ++ +    +  +L+ GD IVT AGI G +V V   +
Sbjct: 4   SYINIIMIVVLFAFMYFMIIRPQSKRNKELKLLQDSLKEGDRIVTFAGIYGDIVEV-GTV 62

Query: 80  ELEVEIAENVRVRVVRSFVSEVQSK 104
            ++V +A  V + + R+ +  + +K
Sbjct: 63  TVKVRVAPKVEIELDRNAIRSIVAK 87


>gi|262195616|ref|YP_003266825.1| preprotein translocase, YajC subunit [Haliangium ochraceum DSM
          14365]
 gi|262078963|gb|ACY14932.1| preprotein translocase, YajC subunit [Haliangium ochraceum DSM
          14365]
          Length = 96

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 18 TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                  +  ++  ++YFLLIRPQ ++ +   ++L  L +GD +VT  G+VGK+     
Sbjct: 1  MGQASPLIMMVLMFGIFYFLLIRPQVKRQKEHQKLLERLDKGDMVVTRGGLVGKISG-TS 59

Query: 78 DLELEVEIAENVRVRVVRSFV 98
             L +E+ E VRVRV+RS V
Sbjct: 60 GSMLTIELQEKVRVRVMRSHV 80


>gi|281423249|ref|ZP_06254162.1| preprotein translocase, YajC subunit [Prevotella oris F0302]
 gi|281402585|gb|EFB33416.1| preprotein translocase, YajC subunit [Prevotella oris F0302]
          Length = 105

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI- 76
              + +  +   + V+++  ++RPQ+++ ++      +L+ G  IVT  GI G + RV  
Sbjct: 13  GGGMGVFIMMGAILVIFWLFMVRPQQKKQKKIRNFQNSLQEGAKIVTGGGIYGTIKRVDV 72

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSEP 107
               ++VEIA  V + V R +V E  S   P
Sbjct: 73  SADTVDVEIARGVVITVSRGYVFEDASSQTP 103


>gi|325688971|gb|EGD30979.1| preprotein translocase [Streptococcus sanguinis SK115]
          Length = 111

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P+ +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPIMLIVFAVVLVGMTYFQM-RAQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +    + +  V   +E
Sbjct: 60  DKKTVVLDVDGVYLTFELAAIKTVLPLTE 88


>gi|183601648|ref|ZP_02963018.1| hypothetical protein BIFLAC_03312 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|241190854|ref|YP_002968248.1| hypothetical protein Balac_0819 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241196260|ref|YP_002969815.1| hypothetical protein Balat_0819 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|183219254|gb|EDT89895.1| hypothetical protein BIFLAC_03312 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|240249246|gb|ACS46186.1| hypothetical protein Balac_0819 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|240250814|gb|ACS47753.1| hypothetical protein Balat_0819 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|295793843|gb|ADG33378.1| hypothetical protein BalV_0790 [Bifidobacterium animalis subsp.
           lactis V9]
          Length = 146

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 35/80 (43%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
             M  +  VL  V  F   R  ++Q Q R     +L  G  ++T  G++GKVV V +  E
Sbjct: 3   YMMLIVLIVLMGVMMFYSSRKAKKQQQERQAFRTSLAPGTEVITIGGLIGKVVEVDEQYE 62

Query: 81  LEVEIAENVRVRVVRSFVSE 100
             V  +E   +R     VS 
Sbjct: 63  EIVLDSEGSLLRFSLQSVSR 82


>gi|218899585|ref|YP_002447996.1| preprotein translocase, YajC subunit [Bacillus cereus G9842]
 gi|228902944|ref|ZP_04067085.1| hypothetical protein bthur0014_41120 [Bacillus thuringiensis IBL
           4222]
 gi|228910252|ref|ZP_04074070.1| hypothetical protein bthur0013_44000 [Bacillus thuringiensis IBL
           200]
 gi|228967492|ref|ZP_04128520.1| hypothetical protein bthur0004_42890 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|218545950|gb|ACK98344.1| preprotein translocase, YajC subunit [Bacillus cereus G9842]
 gi|228792207|gb|EEM39781.1| hypothetical protein bthur0004_42890 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228849416|gb|EEM94252.1| hypothetical protein bthur0013_44000 [Bacillus thuringiensis IBL
           200]
 gi|228856728|gb|EEN01247.1| hypothetical protein bthur0014_41120 [Bacillus thuringiensis IBL
           4222]
          Length = 86

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + +    +   +  ++YFLLIRPQ+++ +  A+M   L +GD+I+T  G+ G +  V DD
Sbjct: 3   AGMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQNELAKGDAIITIGGLHGTIESV-DD 61

Query: 79  LELEVEIAENVRVRVVRSFVSEVQS 103
            ++ ++ +    +   R+ + EV  
Sbjct: 62  TKIVIK-SGGSHLTFDRNAIREVVK 85


>gi|289178593|gb|ADC85839.1| YajC [Bifidobacterium animalis subsp. lactis BB-12]
          Length = 157

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 35/80 (43%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
             M  +  VL  V  F   R  ++Q Q R     +L  G  ++T  G++GKVV V +  E
Sbjct: 14  YMMLIVLIVLMGVMMFYSSRKAKKQQQERQAFRTSLAPGTEVITIGGLIGKVVEVDEQYE 73

Query: 81  LEVEIAENVRVRVVRSFVSE 100
             V  +E   +R     VS 
Sbjct: 74  EIVLDSEGSLLRFSLQSVSR 93


>gi|51598906|ref|YP_073094.1| hypothetical protein BG0674 [Borrelia garinii PBi]
 gi|51573477|gb|AAU07502.1| conserved hypothetical protein [Borrelia garinii PBi]
          Length = 104

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 56/94 (59%), Gaps = 1/94 (1%)

Query: 15  TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
           +S +       +F  +  +++FL+I PQR++ + + EM++NL++GD ++T  GI G VV+
Sbjct: 8   SSNSIFFRSLLVFLPVIAIFWFLVIFPQRKEEKNKKEMIKNLKKGDKVLTIGGIFG-VVK 66

Query: 75  VIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
            + D  + +E+  N+    V++ + +V S+   V
Sbjct: 67  KLGDTNVILELNPNIEAVFVKNSIDKVLSEKNEV 100


>gi|327540450|gb|EGF27035.1| preprotein translocase subunit yajC [Rhodopirellula baltica WH47]
          Length = 139

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 55/111 (49%), Gaps = 8/111 (7%)

Query: 5   VYAQSDAPAITSATSPLEM---AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           + AQ  APA  S+     +     L   +  ++Y     P+R++    A+M+ ++ + D 
Sbjct: 23  LLAQDAAPAGESSILQRILENPLILPVGVVAIFYVTYFGPERRRRAEEAKMMSSMAKNDR 82

Query: 62  IVTAAGIVGKVVRVIDD-LELEVEIAEN--VRVRVVRSFVSEVQ--SKSEP 107
           +VT  GI G +V    D   + ++I EN   R++V RS + ++    K++P
Sbjct: 83  VVTIGGIHGTIVSAAPDSETVTLKIDENGSTRIKVNRSAIVKIVGEPKNKP 133


>gi|210135720|ref|YP_002302159.1| preprotein translocase subunit YajC [Helicobacter pylori P12]
 gi|210133688|gb|ACJ08679.1| preprotein translocase YajC subunit [Helicobacter pylori P12]
          Length = 127

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
            L     F VL +++YFL++RPQRQQ ++  EM+  L +GD IVT  G++ +V++  + 
Sbjct: 6  DILTTLLPFVVLFLIFYFLIVRPQRQQQKKHKEMIEGLTKGDKIVTQGGLIVEVLKA-EA 64

Query: 79 LELEVEIAENVRVRVVRSFVS 99
              V++ ++   ++ +++V+
Sbjct: 65 NFFSVKLNDDTTAKLSKNYVA 85


>gi|220912784|ref|YP_002488093.1| preprotein translocase subunit YajC [Arthrobacter chlorophenolicus
           A6]
 gi|219859662|gb|ACL40004.1| preprotein translocase, YajC subunit [Arthrobacter chlorophenolicus
           A6]
          Length = 181

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID-DLE 80
            M+ L FV+  V+ F++ R  ++  Q++AE+      G  ++T+ G+ G++V + + + +
Sbjct: 29  PMSILLFVMLGVFIFMMFRRNKKTQQQQAELQSKFGPGVDVMTSFGLFGRIVDIDEAENK 88

Query: 81  LEVEIAENVRVRVVRSFVSEVQ 102
           + +E++      V R  V++V 
Sbjct: 89  VTLELSPGNLATVHRQAVTKVM 110


>gi|52141089|ref|YP_085739.1| preprotein translocase subunit YajC [Bacillus cereus E33L]
 gi|228987669|ref|ZP_04147781.1| hypothetical protein bthur0001_43370 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229158031|ref|ZP_04286102.1| hypothetical protein bcere0010_42100 [Bacillus cereus ATCC 4342]
 gi|51974558|gb|AAU16108.1| preprotein translocase, subunit YajC [Bacillus cereus E33L]
 gi|228625484|gb|EEK82240.1| hypothetical protein bcere0010_42100 [Bacillus cereus ATCC 4342]
 gi|228772054|gb|EEM20508.1| hypothetical protein bthur0001_43370 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 86

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   L +GD+IVT  G+ G +  V +  
Sbjct: 4   GMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELAKGDAIVTIGGLHGTIESVDETK 63

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
            +    +    +   R+ + EV  
Sbjct: 64  IVI--KSGGSHLTFDRNAIREVVK 85


>gi|218288859|ref|ZP_03493110.1| preprotein translocase, YajC subunit [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240948|gb|EED08125.1| preprotein translocase, YajC subunit [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 138

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
                  +L VV+Y L++ PQR+Q + RAEM++ L  G  ++T AG+ G++V +  D+ +
Sbjct: 5   SSILFLILLIVVFYVLILLPQRRQQKSRAEMMKKLGPGARVMTTAGLYGEIVAMQGDIAI 64

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEPV 108
            V IA+ V V + +  +  V  +   V
Sbjct: 65  -VRIADGVNVEMDQRAIVRVVEEGRDV 90


>gi|327460713|gb|EGF07048.1| preprotein translocase [Streptococcus sanguinis SK1]
          Length = 111

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P+ +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPIMLIVFAVVLVGMTYFQM-RTQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +    + +  V   +E
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLTE 88


>gi|304317010|ref|YP_003852155.1| preprotein translocase, YajC subunit [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778512|gb|ADL69071.1| preprotein translocase, YajC subunit [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 94

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 49/83 (59%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           + + G   +   ++YFLLI PQ+++ ++   M+  L+ GD I+T +GI G+++ + DD  
Sbjct: 6   IYLIGEIVIFMAIFYFLLILPQQRREKKEKAMIDALKPGDEILTKSGIFGRILNIKDDAI 65

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
                A+ V++++ +  V +V +
Sbjct: 66  TIEVGADKVKLKIAKWSVGKVLN 88


>gi|327488788|gb|EGF20587.1| preprotein translocase [Streptococcus sanguinis SK1058]
          Length = 111

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P+ +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPIMLIVFAVVLVGMTYFQM-RAQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +    + +  V   +E
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLTE 88


>gi|324995989|gb|EGC27900.1| preprotein translocase [Streptococcus sanguinis SK678]
          Length = 111

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 3/92 (3%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P  +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPTMLIVFAVVLVGMTYFQM-RTQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS--KSEP 107
           D +  V   + V +    + +  V    +  P
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLTEGTP 91


>gi|322378150|ref|ZP_08052635.1| preprotein translocase, YajC subunit [Streptococcus sp. M334]
 gi|321280880|gb|EFX57895.1| preprotein translocase, YajC subunit [Streptococcus sp. M334]
          Length = 99

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 36/86 (41%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P     +   L V   F   R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPNYTFLIMLALMVGLMFFTQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDT 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
           +    V   + V +    + +  V  
Sbjct: 61  EKRTIVLDVDGVYLTFELAAIKTVLP 86


>gi|329769849|ref|ZP_08261248.1| preprotein translocase subunit [Gemella sanguinis M325]
 gi|328837903|gb|EGF87527.1| preprotein translocase subunit [Gemella sanguinis M325]
          Length = 87

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                +   L    YF++IRPQ ++ +    +  +L+ GD IVT AGI G +V V   + 
Sbjct: 5   YINILMIVFLFGFMYFMIIRPQSKRNKELKLLQDSLKEGDRIVTFAGIYGDIVEV-GTVT 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQSK 104
           ++V IA  V + + R+ +  + +K
Sbjct: 64  VKVRIAPKVEIELDRNAIRSLATK 87


>gi|154498079|ref|ZP_02036457.1| hypothetical protein BACCAP_02060 [Bacteroides capillosus ATCC
           29799]
 gi|150273069|gb|EDN00226.1| hypothetical protein BACCAP_02060 [Bacteroides capillosus ATCC
           29799]
          Length = 120

 Score = 77.9 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 42/80 (52%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +    +   +  ++YFLLIRP+ ++ +  AEM  +L  GD I T  GIVG +  V +D  
Sbjct: 22  IISIVMIVAMLAIFYFLLIRPENKKKKAMAEMRNSLAVGDLITTIGGIVGTICAVKEDTI 81

Query: 81  LEVEIAENVRVRVVRSFVSE 100
           +    A+ VR+   +  VS 
Sbjct: 82  VIETGADRVRIEFTKWAVST 101


>gi|256391550|ref|YP_003113114.1| preprotein translocase, YajC subunit [Catenulispora acidiphila DSM
           44928]
 gi|256357776|gb|ACU71273.1| preprotein translocase, YajC subunit [Catenulispora acidiphila DSM
           44928]
          Length = 159

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                      ++  ++YF++IRPQ++    +++ML++L+ G  + T A I+G +V V D
Sbjct: 1   MGSPVFLIWIVLIGAMFYFMMIRPQKRARANQSDMLQHLQPGAQVRTTAQIMGTIVEVGD 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D  + VE     R++  +  +  V    E
Sbjct: 61  DWAI-VETTPGTRIKFGKPAIVGVILDDE 88


>gi|225011817|ref|ZP_03702255.1| preprotein translocase, YajC subunit [Flavobacteria bacterium
          MS024-2A]
 gi|225004320|gb|EEG42292.1| preprotein translocase, YajC subunit [Flavobacteria bacterium
          MS024-2A]
          Length = 98

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 42/81 (51%)

Query: 19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
                    ++ VV++F +I PQ+++ ++    + ++ +GD I+T +GI  K++ + D 
Sbjct: 4  GLSGQLPFLLLMLVVFFFFIILPQQRRQKKEKNFMNSMSKGDRIITKSGIHAKIMELNDK 63

Query: 79 LELEVEIAENVRVRVVRSFVS 99
              V      ++++ RS +S
Sbjct: 64 DNTCVIETLAGKLKIERSAIS 84


>gi|187734786|ref|YP_001876898.1| preprotein translocase, YajC subunit [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187424838|gb|ACD04117.1| preprotein translocase, YajC subunit [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 110

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 12  PAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGK 71
           PA            +F ++ V+++ +LIRPQR+  + +   +  L+RGD ++T AG+ G 
Sbjct: 20  PANMFQQILASPMFMFVIIIVLFWVMLIRPQRKAQKEQQARIAALQRGDKVITNAGLHGF 79

Query: 72  VVRVIDDLELEVEIAENVRVRVVRSFVSEV 101
           V +V +   + ++IAE V + + ++ + +V
Sbjct: 80  VEKVNE-RTVSLKIAEGVVIELEKNAIVQV 108


>gi|51892306|ref|YP_074997.1| hypothetical protein STH1168 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855995|dbj|BAD40153.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 85

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID-DLE 80
              G   +L V+ YF++IRPQ+QQ ++R EML +L+ GD IVT  G+ G +  V + +  
Sbjct: 1   MQWGPLILLFVLMYFMMIRPQQQQQKKRQEMLNSLKVGDEIVTIGGLHGVIQAVDETNNT 60

Query: 81  LEVEIAENVRVRVVRSFVSEVQ 102
           + V++A NV +   RS V  V+
Sbjct: 61  IRVKVASNVELTFNRSAVGTVR 82


>gi|302670695|ref|YP_003830655.1| preprotein translocase subunit YajC [Butyrivibrio proteoclasticus
           B316]
 gi|302395168|gb|ADL34073.1| preprotein translocase subunit YajC [Butyrivibrio proteoclasticus
           B316]
          Length = 117

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 13  AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
           A  S+ + L +  ++ VL    YF++IRPQR++ +++A+ L +L  GD++ T  G VG +
Sbjct: 9   AAASSVNTLFIIAIYVVLFGFLYFIMIRPQRKEQKQKAQTLASLAVGDTVRTTGGFVGVI 68

Query: 73  VRVIDD-LELEVEIAENVRVRVVRSFVSEV 101
           + + DD + +E    +N R+ + +  + EV
Sbjct: 69  LDITDDMVIVEFGSNKNCRIPMYKEAIVEV 98


>gi|291544427|emb|CBL17536.1| preprotein translocase, YajC subunit [Ruminococcus sp. 18P13]
          Length = 140

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 1   MFTTVY-AQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRG 59
           MFT+++   ++  A +     L     + ++ V  YF++IRPQR++ +    M  N++ G
Sbjct: 1   MFTSLHTFAAEQSATSGGAYGLVGILPWVIVLVALYFIMIRPQRKKEKETIRMRSNIQIG 60

Query: 60  DSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSE 100
           D I+T  GIVG VVR  +D  +     +  ++R+    V E
Sbjct: 61  DEILTIGGIVGIVVRKGEDTVVIETGGDRSKLRIRIEAVQE 101


>gi|255014273|ref|ZP_05286399.1| hypothetical protein B2_10206 [Bacteroides sp. 2_1_7]
 gi|256841509|ref|ZP_05547016.1| preprotein translocase, YajC subunit [Parabacteroides sp. D13]
 gi|262383322|ref|ZP_06076458.1| preprotein translocase, YajC subunit [Bacteroides sp. 2_1_33B]
 gi|301309372|ref|ZP_07215314.1| preprotein translocase, YajC subunit [Bacteroides sp. 20_3]
 gi|256737352|gb|EEU50679.1| preprotein translocase, YajC subunit [Parabacteroides sp. D13]
 gi|262294220|gb|EEY82152.1| preprotein translocase, YajC subunit [Bacteroides sp. 2_1_33B]
 gi|300832461|gb|EFK63089.1| preprotein translocase, YajC subunit [Bacteroides sp. 20_3]
          Length = 104

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
             +  S      +  V+  ++YF +IRPQ+++ +   +    L+ GD ++TA GI GK+
Sbjct: 9  QAPAGGSQWSGILMMVVIVAIFYFFMIRPQQKKQKEIQKSREALKTGDKVITAGGIYGKI 68

Query: 73 VRVIDDLELEVEIAENVRVRVVRSFV 98
            +  D  + +E+A+ VR+RV ++ +
Sbjct: 69 KEI-GDTYMLIEVADGVRIRVDKTSI 93


>gi|332637239|ref|ZP_08416102.1| preprotein translocase subunit YajC [Weissella cibaria KACC 11862]
          Length = 119

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 41/80 (51%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +  V     YF++IRPQ++  ++R EM+  ++ G  +VT  G+ GK+  V ++ +   
Sbjct: 5   ILILVVFVAAMYFIMIRPQQKAQKKRQEMINTVQPGAEVVTIGGLHGKIAAVDNEAKTFD 64

Query: 84  EIAENVRVRVVRSFVSEVQS 103
             AE V +    S + +V  
Sbjct: 65  LDAEGVILVFELSAIRQVVK 84


>gi|306826334|ref|ZP_07459667.1| preprotein translocase [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|304431447|gb|EFM34430.1| preprotein translocase [Streptococcus sp. oral taxon 071 str.
           73H25AP]
          Length = 106

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 39/91 (42%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P     +  V  +   F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDT 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           +    V   + V +    + +  V    E V
Sbjct: 61  EKRTIVLDVDGVYLTFELAAIKTVLPLKEAV 91


>gi|256820791|ref|YP_003142070.1| preprotein translocase, YajC subunit [Capnocytophaga ochracea DSM
           7271]
 gi|315223934|ref|ZP_07865779.1| preprotein translocase [Capnocytophaga ochracea F0287]
 gi|256582374|gb|ACU93509.1| preprotein translocase, YajC subunit [Capnocytophaga ochracea DSM
           7271]
 gi|314946106|gb|EFS98110.1| preprotein translocase [Capnocytophaga ochracea F0287]
          Length = 102

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 33  VWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVR 92
           V+YF +IRPQ ++ ++    +  ++RGD ++T +G+ G++V + DD  +   ++   +++
Sbjct: 18  VFYFFMIRPQVRRQKQEKNFIEGMKRGDKVITKSGMHGRIVELTDDTCVLETLSG--KIK 75

Query: 93  VVRSFVSEVQS 103
             RS +S   S
Sbjct: 76  FERSAISMELS 86


>gi|119953429|ref|YP_945638.1| protein translocase subunit YajC [Borrelia turicatae 91E135]
 gi|119862200|gb|AAX17968.1| protein translocase subunit YajC [Borrelia turicatae 91E135]
          Length = 107

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 53/79 (67%), Gaps = 1/79 (1%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +F  +  +++FL+I PQR++ +++ +M++NL++GD ++T  GI G +V+ ++D E+ +
Sbjct: 22  LLVFIPVIAIFWFLVISPQRKEEKKKKDMIKNLKKGDKVLTIGGIFG-IVKKVNDSEVIL 80

Query: 84  EIAENVRVRVVRSFVSEVQ 102
           E++    VR +++ V  V 
Sbjct: 81  ELSPTSEVRFIKNSVERVI 99


>gi|46447177|ref|YP_008542.1| preprotein translocase subunit YajC [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|46400818|emb|CAF24267.1| putative preprotein translocase YajC subunit [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 132

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 14  ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
                S  +   +  +  + +Y +L RP++++ +   +    L++GD +V A GI+G VV
Sbjct: 29  PPPDQSFWQTLVMIGIAFLFFYVILWRPEQKRRKALEDQRSALKKGDRVV-AMGIIGTVV 87

Query: 74  RVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           R+ +   + V++ +  ++   ++ ++++  +++
Sbjct: 88  RLGE-QTVIVKMYDGAKLEFYKAAITDILPEAD 119


>gi|306819789|ref|ZP_07453444.1| preprotein translocase [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304552158|gb|EFM40094.1| preprotein translocase [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 134

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           +     ++   +YF +I+PQ+++ Q+  +M  +L+ GD +V  +G+V  +V V +D  + 
Sbjct: 18  LLFPLVIMVAFFYFFIIKPQKKRQQQMEDMKSSLKVGDKVVLYSGLVAVIVAVEEDELIL 77

Query: 83  VEIAENVRVRVVRSFVSEVQS-KSEPV 108
               +NVR+R     +  V + ++EPV
Sbjct: 78  EVEPDNVRLRFKNWCIRNVVADENEPV 104


>gi|332359313|gb|EGJ37134.1| preprotein translocase [Streptococcus sanguinis SK49]
          Length = 111

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P+ +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G +  V  
Sbjct: 1   MNPIMLIVFAVVLVGMTYFQM-RAQKKQAQQRMESLNKLQKGYEVITIGGLYGTIDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +    + +  V   +E
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLAE 88


>gi|308185338|ref|YP_003929471.1| preprotein translocase subunit YajC [Helicobacter pylori SJM180]
 gi|308061258|gb|ADO03154.1| preprotein translocase subunit YajC [Helicobacter pylori SJM180]
          Length = 127

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
            L     F VL +++YFL++RPQRQQ ++  EM+  L +GD IVT  G + +V++  + 
Sbjct: 6  DILTTLLPFVVLFLIFYFLIVRPQRQQQKKHKEMIEGLTKGDKIVTQGGFIVEVLKA-EA 64

Query: 79 LELEVEIAENVRVRVVRSFVS 99
              V++ ++   ++ +++V+
Sbjct: 65 NFFSVKLNDDTTAKLSKNYVA 85


>gi|257464012|ref|ZP_05628397.1| preprotein translocase subunit YajC [Fusobacterium sp. D12]
 gi|317061533|ref|ZP_07926018.1| translocase subunit YajC [Fusobacterium sp. D12]
 gi|313687209|gb|EFS24044.1| translocase subunit YajC [Fusobacterium sp. D12]
          Length = 86

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           +  +  V   ++YFL++RP +++ + + ++  +L  G  +VTA GI G ++ V +D  ++
Sbjct: 7   LILIVLVWGAIFYFLVMRPNKKRQKEQKQLFDSLHEGVEVVTAGGIKGTILYVGEDF-VD 65

Query: 83  VEIAENVRVRVVRSFVSEVQS 103
           V++ + V++ V ++ +S +  
Sbjct: 66  VKVDKGVKLTVRKTSISTIVK 86


>gi|293364543|ref|ZP_06611266.1| preprotein translocase [Streptococcus oralis ATCC 35037]
 gi|307702541|ref|ZP_07639494.1| preprotein translocase, YajC subunit [Streptococcus oralis ATCC
           35037]
 gi|291316955|gb|EFE57385.1| preprotein translocase [Streptococcus oralis ATCC 35037]
 gi|307623887|gb|EFO02871.1| preprotein translocase, YajC subunit [Streptococcus oralis ATCC
           35037]
          Length = 109

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 37/88 (42%), Gaps = 1/88 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +   +  +  F + R Q++Q Q+R E L  L++G  ++T  G+ G V  V     
Sbjct: 8   LTFLIMLVGMFALM-FFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTKKG 66

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSEPV 108
             V   + V +    + +  V    E V
Sbjct: 67  TIVLDVDGVYLTFELAAIKTVLPLKEAV 94


>gi|332365119|gb|EGJ42882.1| preprotein translocase [Streptococcus sanguinis SK1059]
          Length = 111

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P+ +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPIMLIVFAVVLVGMTYFQM-RAQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +    + +  V   +E
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLTE 88


>gi|30022491|ref|NP_834122.1| preprotein translocase subunit YajC [Bacillus cereus ATCC 14579]
 gi|206969902|ref|ZP_03230856.1| preprotein translocase, YajC subunit [Bacillus cereus AH1134]
 gi|218235184|ref|YP_002369225.1| preprotein translocase subunit YajC [Bacillus cereus B4264]
 gi|228923168|ref|ZP_04086459.1| hypothetical protein bthur0011_41480 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228941584|ref|ZP_04104132.1| hypothetical protein bthur0008_42200 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228954700|ref|ZP_04116723.1| hypothetical protein bthur0006_40690 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228974513|ref|ZP_04135080.1| hypothetical protein bthur0003_42660 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228981107|ref|ZP_04141408.1| hypothetical protein bthur0002_42680 [Bacillus thuringiensis Bt407]
 gi|229048125|ref|ZP_04193696.1| hypothetical protein bcere0027_40960 [Bacillus cereus AH676]
 gi|229071924|ref|ZP_04205135.1| hypothetical protein bcere0025_40910 [Bacillus cereus F65185]
 gi|229081680|ref|ZP_04214175.1| hypothetical protein bcere0023_43100 [Bacillus cereus Rock4-2]
 gi|229111888|ref|ZP_04241434.1| hypothetical protein bcere0018_41320 [Bacillus cereus Rock1-15]
 gi|229129696|ref|ZP_04258664.1| hypothetical protein bcere0015_41380 [Bacillus cereus BDRD-Cer4]
 gi|229146987|ref|ZP_04275349.1| hypothetical protein bcere0012_41250 [Bacillus cereus BDRD-ST24]
 gi|229152619|ref|ZP_04280808.1| hypothetical protein bcere0011_41540 [Bacillus cereus m1550]
 gi|229180692|ref|ZP_04308032.1| hypothetical protein bcere0005_40360 [Bacillus cereus 172560W]
 gi|229192627|ref|ZP_04319588.1| hypothetical protein bcere0002_42780 [Bacillus cereus ATCC 10876]
 gi|296504907|ref|YP_003666607.1| preprotein translocase subunit YajC [Bacillus thuringiensis BMB171]
 gi|29898049|gb|AAP11323.1| Protein translocase subunit YajC [Bacillus cereus ATCC 14579]
 gi|206735590|gb|EDZ52758.1| preprotein translocase, YajC subunit [Bacillus cereus AH1134]
 gi|218163141|gb|ACK63133.1| preprotein translocase, YajC subunit [Bacillus cereus B4264]
 gi|228590934|gb|EEK48792.1| hypothetical protein bcere0002_42780 [Bacillus cereus ATCC 10876]
 gi|228602837|gb|EEK60318.1| hypothetical protein bcere0005_40360 [Bacillus cereus 172560W]
 gi|228630880|gb|EEK87520.1| hypothetical protein bcere0011_41540 [Bacillus cereus m1550]
 gi|228636484|gb|EEK92952.1| hypothetical protein bcere0012_41250 [Bacillus cereus BDRD-ST24]
 gi|228653813|gb|EEL09683.1| hypothetical protein bcere0015_41380 [Bacillus cereus BDRD-Cer4]
 gi|228671644|gb|EEL26942.1| hypothetical protein bcere0018_41320 [Bacillus cereus Rock1-15]
 gi|228701684|gb|EEL54175.1| hypothetical protein bcere0023_43100 [Bacillus cereus Rock4-2]
 gi|228711220|gb|EEL63184.1| hypothetical protein bcere0025_40910 [Bacillus cereus F65185]
 gi|228723228|gb|EEL74602.1| hypothetical protein bcere0027_40960 [Bacillus cereus AH676]
 gi|228778648|gb|EEM26914.1| hypothetical protein bthur0002_42680 [Bacillus thuringiensis Bt407]
 gi|228785230|gb|EEM33242.1| hypothetical protein bthur0003_42660 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228805027|gb|EEM51623.1| hypothetical protein bthur0006_40690 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228818091|gb|EEM64168.1| hypothetical protein bthur0008_42200 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228836547|gb|EEM81897.1| hypothetical protein bthur0011_41480 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|296325959|gb|ADH08887.1| preprotein translocase subunit YajC [Bacillus thuringiensis BMB171]
 gi|326942197|gb|AEA18093.1| preprotein translocase subunit YajC [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 86

 Score = 77.5 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + +    +   +  ++YFLLIRPQ+++ +  A+M   L +GD+IVT  G+ G +  V + 
Sbjct: 3   AGMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELAKGDAIVTIGGLHGTIESVDET 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQS 103
             +    +    +   R+ + EV  
Sbjct: 63  KIVI--KSGGSHLTFDRNAIREVVK 85


>gi|228470832|ref|ZP_04055680.1| preprotein translocase, YajC subunit [Porphyromonas uenonis 60-3]
 gi|228307505|gb|EEK16510.1| preprotein translocase, YajC subunit [Porphyromonas uenonis 60-3]
          Length = 108

 Score = 77.5 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 21 LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                F V+ ++++   IRPQ ++ ++  +    L  GDSI+TA G+ G + +V +   
Sbjct: 22 WTSLVFFVVIILIFWLFFIRPQSKRQKKLQQQRDALAVGDSIITAGGVHGVIRKVYE-QT 80

Query: 81 LEVEIAENVRVRVVRSFV 98
           EVEIA++V + + +S V
Sbjct: 81 FEVEIAKDVCIEISKSSV 98


>gi|319940266|ref|ZP_08014618.1| preprotein translocase [Streptococcus anginosus 1_2_62CV]
 gi|319810568|gb|EFW06904.1| preprotein translocase [Streptococcus anginosus 1_2_62CV]
          Length = 112

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             +   +  +  V+  +  F + R Q++Q  +R E L  L++G  ++T  G+ G V  V 
Sbjct: 1   MGNGFSILIMLVVMMGLM-FFMQRSQKKQADKRMESLNKLQKGYEVITIGGLYGTVDEVD 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +  V   + V +    + +  V   +E
Sbjct: 60  TEKKTVVLDVDGVYLTFELTAIKTVLPLTE 89


>gi|226324598|ref|ZP_03800116.1| hypothetical protein COPCOM_02382 [Coprococcus comes ATCC 27758]
 gi|225207046|gb|EEG89400.1| hypothetical protein COPCOM_02382 [Coprococcus comes ATCC 27758]
          Length = 92

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID- 77
           +P+ +   + V+   +++LL+RPQ+++ +R   ML  L  GD+++T +G  G V+ + D 
Sbjct: 3   NPIVLILFYVVIIGGFWWLLMRPQKKEQKRVQLMLSELAVGDTVLTTSGFYGVVIDITDE 62

Query: 78  DLELEVEIAENVRVRVVRSFVSEV 101
           D+ +E    +N R+ + +S + +V
Sbjct: 63  DVIVEFGSNKNCRIPMQKSAIMQV 86


>gi|315222084|ref|ZP_07863994.1| preprotein translocase, YajC subunit [Streptococcus anginosus
           F0211]
 gi|315188834|gb|EFU22539.1| preprotein translocase, YajC subunit [Streptococcus anginosus
           F0211]
          Length = 112

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             +   +  +  V+  +  F + R Q++Q  +R E L  L++G  ++T  G+ G V  V 
Sbjct: 1   MGNGFSVLIMLVVMMGLM-FFMQRSQKKQADKRMESLNKLQKGYEVITIGGLYGTVDEVD 59

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
            + +  V   + V +    + +  V   +E
Sbjct: 60  TEKKTVVLDVDGVYLTFELTAIKTVLPLTE 89


>gi|310658615|ref|YP_003936336.1| hypothetical protein CLOST_1311 [Clostridium sticklandii DSM 519]
 gi|308825393|emb|CBH21431.1| conserved protein of unknown function [Clostridium sticklandii]
          Length = 88

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 49/81 (60%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    + F+  +++Y LLIRPQ+++ +   EM  +L+ GD++VT  G+VGK+V++ +D  
Sbjct: 6   LSSLVIPFIFLIIFYLLLIRPQQKREKSIKEMRNSLKVGDNVVTIGGMVGKIVKIFEDEV 65

Query: 81  LEVEIAENVRVRVVRSFVSEV 101
                ++  ++ + +  ++ V
Sbjct: 66  TIEIGSDKTKITLEKWGIARV 86


>gi|332520934|ref|ZP_08397394.1| preprotein translocase, YajC subunit [Lacinutrix algicola 5H-3-7-4]
 gi|332043464|gb|EGI79660.1| preprotein translocase, YajC subunit [Lacinutrix algicola 5H-3-7-4]
          Length = 95

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 42/88 (47%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
              +        +  V YF +I PQ ++ +   +    L+RGD ++T +G+ GK+V + +
Sbjct: 1   MGEISSFLPILAMFAVVYFFMIAPQMKRAKNEKKFAAELKRGDKVITKSGMHGKIVELNE 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKS 105
                +    + +++  R+ +S   SK+
Sbjct: 61  KDNSCIIETMSGKLKFDRAAISMESSKA 88


>gi|325697428|gb|EGD39314.1| preprotein translocase [Streptococcus sanguinis SK160]
          Length = 111

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 3/92 (3%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P  +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPTMLIVFAVVLVGMTYFQM-RTQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS--KSEP 107
           D +  V   + V +    + +  V    +  P
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLTEGTP 91


>gi|293375250|ref|ZP_06621534.1| preprotein translocase, YajC subunit [Turicibacter sanguinis PC909]
 gi|325840675|ref|ZP_08167126.1| preprotein translocase, YajC subunit [Turicibacter sp. HGF1]
 gi|292646148|gb|EFF64174.1| preprotein translocase, YajC subunit [Turicibacter sanguinis PC909]
 gi|325490239|gb|EGC92573.1| preprotein translocase, YajC subunit [Turicibacter sp. HGF1]
          Length = 87

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
           +   + +   F +L V+ YF +IRP+ ++ +  A M  +L +GD +VT  G+ G++   +
Sbjct: 2   SADMIVLIIQFALLGVIIYFFMIRPESKRRKAVASMQSSLNKGDRVVTIGGVHGRI-HAL 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSE 100
           ++  + +   E  +    RS ++ 
Sbjct: 61  EETTVTLINDEGAKWTFERSAIAR 84


>gi|219684159|ref|ZP_03539103.1| preprotein translocase, YajC subunit [Borrelia garinii PBr]
 gi|219672148|gb|EED29201.1| preprotein translocase, YajC subunit [Borrelia garinii PBr]
          Length = 111

 Score = 77.1 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 54/85 (63%), Gaps = 1/85 (1%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +F  +  +++FL+I PQR++ + + EM++NL++GD ++T  GI G VV+ + D ++ +
Sbjct: 24  LLVFLPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGDKVLTIGGIFG-VVKKLGDTDVIL 82

Query: 84  EIAENVRVRVVRSFVSEVQSKSEPV 108
           E+  N+    V++ + +V S+   V
Sbjct: 83  ELNPNIEAVFVKNSIDKVLSEKNEV 107


>gi|219685715|ref|ZP_03540528.1| preprotein translocase, YajC subunit [Borrelia garinii Far04]
 gi|219672765|gb|EED29791.1| preprotein translocase, YajC subunit [Borrelia garinii Far04]
          Length = 111

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 54/85 (63%), Gaps = 1/85 (1%)

Query: 24  AGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83
             +F  +  +++FL+I PQR++ + + EM++NL++GD ++T  GI G VV+ + D ++ +
Sbjct: 24  LLVFLPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGDKVLTIGGIFG-VVKKLGDTDVIL 82

Query: 84  EIAENVRVRVVRSFVSEVQSKSEPV 108
           E+  N+    V++ + +V S+   V
Sbjct: 83  ELNPNIEAVFVKNSIDKVLSEKNEV 107


>gi|150008473|ref|YP_001303216.1| hypothetical protein BDI_1859 [Parabacteroides distasonis ATCC
          8503]
 gi|298376258|ref|ZP_06986214.1| preprotein translocase, YajC subunit [Bacteroides sp. 3_1_19]
 gi|149936897|gb|ABR43594.1| conserved hypothetical protein with conserved domain
          [Parabacteroides distasonis ATCC 8503]
 gi|298267295|gb|EFI08952.1| preprotein translocase, YajC subunit [Bacteroides sp. 3_1_19]
          Length = 104

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 13 AITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKV 72
             +  S      +  V+  ++YF +IRPQ+++ +   +    L+ GD ++TA GI GK+
Sbjct: 9  QTPAGGSQWSGILMMVVIVAIFYFFMIRPQQKKQKEIQKSREALKTGDKVITAGGIYGKI 68

Query: 73 VRVIDDLELEVEIAENVRVRVVRSFV 98
            +  D  + +E+A+ VR+RV ++ +
Sbjct: 69 KEI-GDTYMLIEVADGVRIRVDKTSI 93


>gi|332365816|gb|EGJ43573.1| preprotein translocase [Streptococcus sanguinis SK355]
          Length = 111

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P  +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPTMLIVFAVVLIGMTYFQM-RAQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +    + +  V   +E
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLTE 88


>gi|242373938|ref|ZP_04819512.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus epidermidis M23864:W1]
 gi|242348292|gb|EES39894.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus epidermidis M23864:W1]
          Length = 87

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 34/86 (39%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
                   L  +L  V +F LIRPQ+++ +   EM+  +  G  + T  GI G V  V +
Sbjct: 1   MGQFASLILPILLLAVMWFFLIRPQQKRAKAHREMISRVESGQKVTTIGGIKGTVKSVDE 60

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQS 103
              +         +   +  + +V  
Sbjct: 61  TTVVITVNGHGTEMTFEKPAIKQVDP 86


>gi|32267145|ref|NP_861177.1| preprotein translocase subunit YajC [Helicobacter hepaticus ATCC
          51449]
 gi|32263198|gb|AAP78243.1| conserved hypothetical protein [Helicobacter hepaticus ATCC
          51449]
          Length = 97

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 14 ITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVV 73
             A   L           ++Y LLIRP   + ++  EM+  L++GD I+T  G++ ++V
Sbjct: 2  QGGAQETLMSLLPIVFFIAIFYLLLIRPANVKRKKHQEMIDALQKGDKIITTGGLICEIV 61

Query: 74 RVIDDLELEVEIAENVRVRVVRSFVS 99
          +  +     V + ++  V++ R F++
Sbjct: 62 K-PEKTFFSVRLNDDTIVKLSREFIA 86


>gi|219683818|ref|YP_002470201.1| preprotein translocase, YajC subunit [Bifidobacterium animalis
           subsp. lactis AD011]
 gi|219621468|gb|ACL29625.1| preprotein translocase, YajC subunit [Bifidobacterium animalis
           subsp. lactis AD011]
          Length = 142

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 35/78 (44%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M  +  VL  V  F   R  ++Q Q R     +L  G  ++T  G++GKVV V +  E  
Sbjct: 1   MLIVLIVLMGVMMFYSSRKAKKQQQERQAFRTSLAPGTEVITIGGLIGKVVEVDEQYEEI 60

Query: 83  VEIAENVRVRVVRSFVSE 100
           V  +E   +R     VS 
Sbjct: 61  VLDSEGSLLRFSLQSVSR 78


>gi|313676015|ref|YP_004054011.1| protein translocase subunit yajc [Marivirga tractuosa DSM 4126]
 gi|312942713|gb|ADR21903.1| protein translocase subunit yajC [Marivirga tractuosa DSM 4126]
          Length = 105

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 29/104 (27%), Positives = 60/104 (57%), Gaps = 4/104 (3%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           M   + AQ+        ++ +    LF  + +V+YF +IRPQ+++ + + + +  +++GD
Sbjct: 1   MIQFILAQAT---TGDDSAWMSQLLLFGGIILVFYFFMIRPQQKKQKDQKKFIAEIKKGD 57

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK 104
           ++VT  G+ GKV +V +D  + +E+ +  ++   +S VS  QSK
Sbjct: 58  AVVTIGGLHGKVYQVEEDK-IILEVDKGTKMIFEKSAVSLEQSK 100


>gi|88802777|ref|ZP_01118304.1| hypothetical protein PI23P_09305 [Polaribacter irgensii 23-P]
 gi|88781635|gb|EAR12813.1| hypothetical protein PI23P_09305 [Polaribacter irgensii 23-P]
          Length = 105

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           MF T++ Q DA +       L     F  + +V YF +IRPQ ++ ++       ++ G 
Sbjct: 1   MFYTIFLQFDAAS-------LTSMLPFAAMILVLYFFMIRPQMKRQKKEKTFQAEIKTGA 53

Query: 61  SIVTAAGIVGKVVRV-IDDLELEVEIAENVRVRVVRSFVSEVQS 103
            +VTA+GI GK+  V   D  + +E     +++   S +S   S
Sbjct: 54  KVVTASGIHGKITEVNTTDKTITIETGAG-KIKFESSVISMELS 96


>gi|288904423|ref|YP_003429644.1| preprotein translocase subunit YajC [Streptococcus gallolyticus
           UCN34]
 gi|306830456|ref|ZP_07463626.1| preprotein translocase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325977420|ref|YP_004287136.1| preprotein translocase subunit YajC [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|288731148|emb|CBI12696.1| preprotein translocase subunit YajC [Streptococcus gallolyticus
           UCN34]
 gi|304427481|gb|EFM30583.1| preprotein translocase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177348|emb|CBZ47392.1| yajC [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 123

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +    +  VL  + +F + R Q++Q Q R   L+ L +GD IVT  G+ G V  V +D +
Sbjct: 1   MGTIIMLVVLVGMIWF-MQRSQKKQAQERQNQLKELAKGDEIVTIGGLYGVVDEVDEDNQ 59

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKSE 106
             V   + V +    S +  V +++E
Sbjct: 60  KMVLDIDGVYLTFELSALKRVINRAE 85


>gi|268609562|ref|ZP_06143289.1| hypothetical protein RflaF_08702 [Ruminococcus flavefaciens FD-1]
          Length = 172

 Score = 77.1 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 53/99 (53%)

Query: 8   QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAG 67
            S +  +T +++ L M     +L  + YF+ IRPQ+++ Q   EM  N++ GD IVT  G
Sbjct: 39  ASSSQEMTPSSAFLSMGLPMLILFALLYFVAIRPQKKRDQEMKEMQANIQVGDEIVTGGG 98

Query: 68  IVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           IVG VV + DD  +        ++R+    ++E  + +E
Sbjct: 99  IVGIVVSIGDDTVVIETGGAKHKLRIKNWAITENVTAAE 137


>gi|258512072|ref|YP_003185506.1| preprotein translocase, YajC subunit [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478798|gb|ACV59117.1| preprotein translocase, YajC subunit [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 135

 Score = 76.7 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
                  +L VV+Y L++ PQR+Q + RAEM++ L  G  ++TAAG+ G++V +  D+ +
Sbjct: 5   SSILFLILLIVVFYVLILLPQRRQQKSRAEMMKKLGPGARVMTAAGLYGEIVAMQGDIAI 64

Query: 82  EVEIAENVRVRVVRSFVSEVQSKSEPV 108
            V IA+ V V + +  +  V  +   V
Sbjct: 65  -VRIADGVDVEMDQRAIVRVVEEGRDV 90


>gi|125718862|ref|YP_001035995.1| preprotein translocase subunit YajC [Streptococcus sanguinis SK36]
 gi|323350538|ref|ZP_08086200.1| preprotein translocase [Streptococcus sanguinis VMC66]
 gi|125498779|gb|ABN45445.1| Preprotein translocase subunit YajC, putative [Streptococcus
           sanguinis SK36]
 gi|322123220|gb|EFX94905.1| preprotein translocase [Streptococcus sanguinis VMC66]
 gi|324989754|gb|EGC21697.1| preprotein translocase [Streptococcus sanguinis SK353]
 gi|324992481|gb|EGC24402.1| preprotein translocase [Streptococcus sanguinis SK405]
 gi|325686590|gb|EGD28616.1| preprotein translocase [Streptococcus sanguinis SK72]
 gi|325695488|gb|EGD37388.1| preprotein translocase [Streptococcus sanguinis SK150]
 gi|327462762|gb|EGF09084.1| preprotein translocase [Streptococcus sanguinis SK1057]
 gi|327468393|gb|EGF13878.1| preprotein translocase [Streptococcus sanguinis SK330]
 gi|327472434|gb|EGF17865.1| preprotein translocase [Streptococcus sanguinis SK408]
 gi|332359975|gb|EGJ37789.1| preprotein translocase [Streptococcus sanguinis SK1056]
          Length = 111

 Score = 76.7 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P+ +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPIMLIVFAVVLVGMTYFQM-RAQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +    + +  V   +E
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLTE 88


>gi|229076047|ref|ZP_04209018.1| hypothetical protein bcere0024_41300 [Bacillus cereus Rock4-18]
 gi|229098890|ref|ZP_04229826.1| hypothetical protein bcere0020_41140 [Bacillus cereus Rock3-29]
 gi|229105054|ref|ZP_04235706.1| hypothetical protein bcere0019_41880 [Bacillus cereus Rock3-28]
 gi|229117916|ref|ZP_04247278.1| hypothetical protein bcere0017_41860 [Bacillus cereus Rock1-3]
 gi|228665573|gb|EEL21053.1| hypothetical protein bcere0017_41860 [Bacillus cereus Rock1-3]
 gi|228678364|gb|EEL32589.1| hypothetical protein bcere0019_41880 [Bacillus cereus Rock3-28]
 gi|228684563|gb|EEL38505.1| hypothetical protein bcere0020_41140 [Bacillus cereus Rock3-29]
 gi|228707081|gb|EEL59283.1| hypothetical protein bcere0024_41300 [Bacillus cereus Rock4-18]
          Length = 86

 Score = 76.7 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 19  SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78
           + +    +   +  ++YFLLIRPQ+++ +  A+M   L +GD+I+T  G+ G +  V + 
Sbjct: 3   AGMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQNELAKGDAIITIGGLHGTIESVDET 62

Query: 79  LELEVEIAENVRVRVVRSFVSEVQS 103
             +    +    +   R+ + EV  
Sbjct: 63  KIVV--KSGGAHLTFDRNAIREVVK 85


>gi|225181931|ref|ZP_03735365.1| preprotein translocase, YajC subunit [Dethiobacter alkaliphilus AHT
           1]
 gi|225167371|gb|EEG76188.1| preprotein translocase, YajC subunit [Dethiobacter alkaliphilus AHT
           1]
          Length = 90

 Score = 76.7 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             + L     F +L V++YFLLIRPQ+QQ ++R E+L +L+ GD + T  G  G + ++ 
Sbjct: 1   MPAELINFAPFIILLVLFYFLLIRPQQQQQKKRKELLESLKVGDDVRTIGGFYGTIEKIN 60

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           DD  + + +A+NVR+R+ R  V  +  K +
Sbjct: 61  DD-VVTLRVADNVRLRLARFGVESIVQKDQ 89


>gi|119960635|ref|YP_948035.1| preprotein translocase subunit YajC [Arthrobacter aurescens TC1]
 gi|119947494|gb|ABM06405.1| preprotein translocase, YajC subunit [Arthrobacter aurescens TC1]
          Length = 142

 Score = 76.7 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID-DLE 80
            M  L FV+  ++ F++ R  ++  Q++AEM      G  ++T+ G+ G++V + + + +
Sbjct: 15  PMTILLFVMLGLFVFMMFRRNKKTQQQQAEMQSKFAPGVDVMTSFGLFGRIVSIDEAENK 74

Query: 81  LEVEIAENVRVRVVRSFVSEVQ---SKSEPV 108
           + +E++   +  V R  V++V     +  PV
Sbjct: 75  VVIELSPGNQATVHRQAVTKVVETTPEEAPV 105


>gi|328944576|gb|EGG38737.1| preprotein translocase [Streptococcus sanguinis SK1087]
          Length = 111

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 18  TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVID 77
            +P+ +     VL  + YF + R Q++Q Q+R E L  L++G  ++T  G+ G V  V  
Sbjct: 1   MNPIMLIVFAVVLVGMTYFQM-RTQKKQAQQRMESLNKLQKGYEVITIGGLYGTVDEVDT 59

Query: 78  DLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           D +  V   + V +    + +  V   +E
Sbjct: 60  DKKTVVLDVDGVYLTFELTAIKTVLPLTE 88


>gi|228960689|ref|ZP_04122333.1| hypothetical protein bthur0005_41500 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228798995|gb|EEM45968.1| hypothetical protein bthur0005_41500 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 86

 Score = 76.7 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 20  PLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDL 79
            +    +   +  ++YFLLIRPQ+++ +  A+M   L +GD+IVT  G+ G +  V +  
Sbjct: 4   GMMNIVMIVAMFAIFYFLLIRPQQKRQKAVAQMQSELAKGDAIVTIGGLHGTIESVDETK 63

Query: 80  ELEVEIAENVRVRVVRSFVSEVQS 103
            +    +    +   R+ + EV  
Sbjct: 64  IVI--KSGGSHLTFDRNAIREVVK 85


>gi|315923968|ref|ZP_07920196.1| preprotein translocase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622808|gb|EFV02761.1| preprotein translocase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 134

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 48/87 (55%)

Query: 17  ATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVI 76
             +PL       +LAV  YF++IRPQ ++ ++  +ML N++ GD ++TA G  G +  + 
Sbjct: 4   QGNPLVNILPVIILAVFLYFVMIRPQSKRQKKVNDMLANMKIGDEVMTAGGFYGIINALD 63

Query: 77  DDLELEVEIAENVRVRVVRSFVSEVQS 103
           D+  +   + +  +V + +  + +V +
Sbjct: 64  DENVVLELLPDFQKVMIRKQSIVKVIT 90


>gi|167766772|ref|ZP_02438825.1| hypothetical protein CLOSS21_01280 [Clostridium sp. SS2/1]
 gi|317499053|ref|ZP_07957334.1| preprotein translocase subunit [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167711526|gb|EDS22105.1| hypothetical protein CLOSS21_01280 [Clostridium sp. SS2/1]
 gi|291560702|emb|CBL39502.1| protein translocase subunit yajC [butyrate-producing bacterium
           SSC/2]
 gi|316893703|gb|EFV15904.1| preprotein translocase subunit [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 97

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 22  EMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLEL 81
               +  V   + YFL IRPQ+++ +   +M+  L  GDS++T +G  G VV  +D+  +
Sbjct: 6   MTILMLVVCFGLMYFLTIRPQKKKEEELKQMMETLEVGDSVLTTSGFYGVVVDKVDETTI 65

Query: 82  EVEIAEN--VRVRVVRSFVSE 100
            VE   +   R+ + +S +  
Sbjct: 66  IVEFGNDKHCRIPMEKSAIQA 86


>gi|289167114|ref|YP_003445381.1| preprotein translocase subunit [Streptococcus mitis B6]
 gi|288906679|emb|CBJ21513.1| preprotein translocase subunit [Streptococcus mitis B6]
          Length = 99

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
                +   +  +  F   R Q++Q Q+R E L  L++G  ++T  G+ G V  V  + +
Sbjct: 5   YTFLIMLVAMLGLM-FFTQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKK 63

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
             V   + V +    + +  V  
Sbjct: 64  TIVLDVDGVYLTFELAAIKTVLP 86


>gi|251772531|gb|EES53097.1| preprotein translocase, YajC subunit [Leptospirillum
           ferrodiazotrophum]
          Length = 99

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 8   QSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAG 67
            +   +  S+   L       ++ V++Y L+I PQ+++ ++ AE L  L+ GD +VT  G
Sbjct: 1   MNTQASAGSSAQTLMQIVPILLIVVLFYALVIMPQKKRQKKMAEFLSALKVGDRVVTGGG 60

Query: 68  IVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKS 105
           +VG +  + +  E+ +EIA  V + V+R  V  +    
Sbjct: 61  LVGTITAIGE-KEISLEIAPGVVITVMRQAVLALAGDG 97


>gi|299822810|ref|ZP_07054696.1| preprotein translocase [Listeria grayi DSM 20601]
 gi|299816339|gb|EFI83577.1| preprotein translocase [Listeria grayi DSM 20601]
          Length = 107

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 3/88 (3%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           ++M     ++ V++YFLLIRPQ+++ ++  +M   L +GD I+T  G+ G +V  I+D  
Sbjct: 1   MQMLIPLVLMIVLFYFLLIRPQQKRQKQVQQMQSGLSKGDKIITIGGLHG-IVDAIEDNT 59

Query: 81  LEVEIAENVRVRVVRSFVSEVQSKS-EP 107
           + +      R+   R+ +  V  K+ EP
Sbjct: 60  VILN-CGGARLTFDRNAIRTVLEKTAEP 86


>gi|242242910|ref|ZP_04797355.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus epidermidis W23144]
 gi|242233625|gb|EES35937.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus epidermidis W23144]
 gi|319400964|gb|EFV89183.1| preprotein translocase, YajC subunit [Staphylococcus epidermidis
           FRI909]
          Length = 86

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 37/83 (44%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +  +L VV YFLLIRPQ+++ +    M+  +  G  I T  GI G +  V +   
Sbjct: 3   LTSLIIPILLLVVMYFLLIRPQQKRAKEHRAMINRVEAGQRITTIGGIKGTIKAVDETSV 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           +    +    +   +  + +V  
Sbjct: 63  IITVNSNGTEMTFEKPAIKQVDP 85


>gi|304440168|ref|ZP_07400059.1| preprotein translocase [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371431|gb|EFM25046.1| preprotein translocase [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 99

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 47/82 (57%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           +       +L + +YF +I+PQ+++ +    M  N++ GD+I+T  GIVGKV++V +D+ 
Sbjct: 9   ITSFAPLIILMIFFYFFMIKPQKKKEKEIQTMRENIKVGDNIITIGGIVGKVIQVKEDVI 68

Query: 81  LEVEIAENVRVRVVRSFVSEVQ 102
                 +  ++ +++  ++ V 
Sbjct: 69  FIETSGDKTKLELMKWGINSVL 90


>gi|260221943|emb|CBA31012.1| UPF0092 membrane protein yajC [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 69

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 39  IRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV 98
           +RPQ ++ +    M+  L +GD +VTA G++GKV ++  D  + +E+A  V V+V RS V
Sbjct: 1   MRPQMKKQKEHRAMIDALAKGDEVVTAGGVLGKVSKL-GDSYVGLEVASGVEVQVQRSAV 59

Query: 99  SEVQSKS 105
            +V  K 
Sbjct: 60  VQVLPKG 66


>gi|289550597|ref|YP_003471501.1| Preprotein translocase subunit YajC [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658092|ref|ZP_07910964.1| preprotein translocase [Staphylococcus lugdunensis M23590]
 gi|289180129|gb|ADC87374.1| Preprotein translocase subunit YajC [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496421|gb|EFU84744.1| preprotein translocase [Staphylococcus lugdunensis M23590]
          Length = 86

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 37/83 (44%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +  +  +V+YFL+IRPQ+++ +   EM+  +  G  I T  G+ G V  V +   
Sbjct: 3   LTAILIPVLFLLVFYFLIIRPQQKRAKEHREMVNRVEAGQKITTIGGLKGTVKAVDETTV 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           +         +   +  + +V  
Sbjct: 63  VITVNGHGTEMTFEKPAIKQVDP 85


>gi|27468239|ref|NP_764876.1| hypothetical protein SE1321 [Staphylococcus epidermidis ATCC 12228]
 gi|57867141|ref|YP_188777.1| preprotein translocase, YajC subunit [Staphylococcus epidermidis
           RP62A]
 gi|251811043|ref|ZP_04825516.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875937|ref|ZP_06284804.1| preprotein translocase, YajC subunit [Staphylococcus epidermidis
           SK135]
 gi|293366405|ref|ZP_06613084.1| preprotein translocase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|27315785|gb|AAO04920.1|AE016748_154 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|57637799|gb|AAW54587.1| preprotein translocase, YajC subunit [Staphylococcus epidermidis
           RP62A]
 gi|251805419|gb|EES58076.1| Sec family type I general secretory pathway preprotein translocase
           subunit YajC [Staphylococcus epidermidis BCM-HMP0060]
 gi|281294962|gb|EFA87489.1| preprotein translocase, YajC subunit [Staphylococcus epidermidis
           SK135]
 gi|291319530|gb|EFE59897.1| preprotein translocase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329724648|gb|EGG61154.1| preprotein translocase, YajC subunit [Staphylococcus epidermidis
           VCU144]
 gi|329733738|gb|EGG70064.1| preprotein translocase, YajC subunit [Staphylococcus epidermidis
           VCU045]
 gi|329737263|gb|EGG73517.1| preprotein translocase, YajC subunit [Staphylococcus epidermidis
           VCU028]
          Length = 86

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 37/83 (44%)

Query: 21  LEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLE 80
           L    +  +L VV YFLLIRPQ+++ +    M+  +  G  I T  GI G +  V +   
Sbjct: 3   LTSLIIPILLLVVMYFLLIRPQQKRAKEHRAMINRVEAGQKITTIGGIKGTIKAVDETSV 62

Query: 81  LEVEIAENVRVRVVRSFVSEVQS 103
           +    +    +   +  + +V  
Sbjct: 63  IITVNSNGTEMTFEKPAIKQVDP 85


>gi|260583675|ref|ZP_05851423.1| preprotein translocase, YajC subunit [Granulicatella elegans ATCC
           700633]
 gi|260158301|gb|EEW93369.1| preprotein translocase, YajC subunit [Granulicatella elegans ATCC
           700633]
          Length = 99

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 23  MAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE 82
           M      L   W+F   R  R++ ++  E +  L+ GD +VT  G+ G VV  ID ++  
Sbjct: 7   MLLYIVALGGAWWFFG-RKNRERTKKLQEQMNALKAGDHVVTIGGLHG-VVHYIDTVDQT 64

Query: 83  VEI-AENVRVRVVRSFVSEVQS 103
           VEI  + V +   R  +  V  
Sbjct: 65  VEIDCDGVYLTFERRAIHHVVP 86


>gi|322437196|ref|YP_004219408.1| preprotein translocase, YajC subunit [Acidobacterium sp. MP5ACTX9]
 gi|321164923|gb|ADW70628.1| preprotein translocase, YajC subunit [Acidobacterium sp. MP5ACTX9]
          Length = 104

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 47/93 (50%)

Query: 11  APAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVG 70
             A       +    L  +  V  YFL+I P +++ +   +ML +L+ GD++ +  G+ G
Sbjct: 7   QSAGFLGNGGITSLALPVLFFVALYFLMIAPNQKKQKAWTQMLADLKSGDTVTSTGGLRG 66

Query: 71  KVVRVIDDLELEVEIAENVRVRVVRSFVSEVQS 103
            V++V DD  +     + V++  V+S ++ V +
Sbjct: 67  LVLQVKDDCVIVRTQPDGVKLEFVKSSIAAVVT 99


>gi|34557614|ref|NP_907429.1| preprotein translocase subunit YajC [Wolinella succinogenes DSM
          1740]
 gi|34483331|emb|CAE10329.1| PUTATIVE MEMBRANE PROTEIN [Wolinella succinogenes]
          Length = 93

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 15 TSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVR 74
                L+      VL  ++YFL+I PQ++Q +R  EM+ NL++GD IV   G + +V++
Sbjct: 2  QGTAEILQSLLPLVVLFAIFYFLIIMPQQRQQKRHKEMIANLKKGDKIVMQGGFIVEVIK 61

Query: 75 VIDDLELEVEIAENVRVRVVRSFVS 99
          V ++    V++ +    ++ + FV+
Sbjct: 62 V-EENHFTVKLNDETTAKLAKDFVA 85


>gi|171915959|ref|ZP_02931429.1| hypothetical protein VspiD_32350 [Verrucomicrobium spinosum DSM
           4136]
          Length = 114

 Score = 75.9 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 53/105 (50%), Gaps = 2/105 (1%)

Query: 2   FTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDS 61
           F+++   + A              +  ++ V+ YF+LIRPQR++ + +  + + L  GD 
Sbjct: 3   FSSIIVIAQAAPAGQPGGGSSTIIMMVLMMVMMYFILIRPQRKKQKEQETLQKALSAGDE 62

Query: 62  IVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSE 106
           +VT  G  G V  V +   + V+ AE  +V   R+ ++  ++K+E
Sbjct: 63  VVTIGGAHGVVATVKE-KTVVVKFAEG-KVEFDRTAIAHKKAKAE 105


>gi|291515764|emb|CBK64974.1| preprotein translocase,