RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|255764512|ref|YP_003065529.2| preprotein tranlocase protein [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Length = 215 Score = 25.6 bits (55), Expect = 1.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Query: 49 RAEMLRNLRRGDSIVTAAGIVGK 71 RA+ML + R + AG GK Sbjct: 1 RAQMLAEIMRFRHGIAVAGTHGK 23 >d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 286 Score = 25.2 bits (54), Expect = 1.6 Identities = 7/36 (19%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Query: 48 RRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEV 83 R + G + A +G R++D++ +E+ Sbjct: 251 RDIGLGPMPLNGSGRLLVAARLGTT-RLLDNIAIEI 285 >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 Score = 24.9 bits (54), Expect = 1.9 Identities = 13/73 (17%), Positives = 27/73 (36%), Gaps = 2/73 (2%) Query: 26 LFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELE-VE 84 L V + +L++P ++ + N D AG + +V +L ++ Sbjct: 65 LLVVRSGSAILVLVKPDDRR-EYFFLTSDNPIFSDHQKIPAGTIFYLVNPDPKEDLRIIQ 123 Query: 85 IAENVRVRVVRSF 97 +A V + F Sbjct: 124 LAMPVNNPQIHEF 136 >d3c2wa2 d.110.2.4 (A:310-494) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} Length = 185 Score = 23.8 bits (51), Expect = 3.8 Identities = 7/23 (30%), Positives = 10/23 (43%) Query: 43 RQQLQRRAEMLRNLRRGDSIVTA 65 R +RR + R R D + A Sbjct: 7 RVSTERRLALARRARDADDLFGA 29 >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 Score = 23.7 bits (51), Expect = 5.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 40 RPQRQQLQRRAEMLRNLRRGDSIVTAAGIV 69 +QQLQ + +R+ GD +V G+ Sbjct: 95 SRSQQQLQDSHQKIRHFNEGDVLVIPPGVP 124 >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 Score = 23.3 bits (50), Expect = 5.2 Identities = 10/33 (30%), Positives = 13/33 (39%), Gaps = 3/33 (9%) Query: 40 RPQRQQLQRRAEM---LRNLRRGDSIVTAAGIV 69 QR Q R + + N R GD I G+ Sbjct: 89 PQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVA 121 >d3cdda1 b.106.1.1 (A:181-348) Baseplate protein gpP {Shewanella oneidensis [TaxId: 70863]} Length = 168 Score = 22.5 bits (48), Expect = 9.3 Identities = 5/27 (18%), Positives = 10/27 (37%) Query: 44 QQLQRRAEMLRNLRRGDSIVTAAGIVG 70 + +R + R G S + + G Sbjct: 81 EGAAKRGQWERQRSIGKSNMAEYTVTG 107 >d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} Length = 282 Score = 22.5 bits (47), Expect = 9.3 Identities = 6/25 (24%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Query: 59 GDSIVTAAGIVGKVVRVIDDLELEV 83 +++ A +G R+ID+ +E+ Sbjct: 259 KRAVILVAAWLGDA-RLIDNKMVEL 282 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.324 0.135 0.368 Gapped Lambda K H 0.267 0.0641 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 365,105 Number of extensions: 15066 Number of successful extensions: 74 Number of sequences better than 10.0: 1 Number of HSP's gapped: 74 Number of HSP's successfully gapped: 22 Length of query: 108 Length of database: 2,407,596 Length adjustment: 68 Effective length of query: 40 Effective length of database: 1,473,956 Effective search space: 58958240 Effective search space used: 58958240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.1 bits)