BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764512|ref|YP_003065529.2| preprotein tranlocase protein [Candidatus Liberibacter asiaticus str. psy62] (108 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764512|ref|YP_003065529.2| preprotein tranlocase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 108 Score = 214 bits (546), Expect = 3e-58, Method: Compositional matrix adjust. Identities = 108/108 (100%), Positives = 108/108 (100%) Query: 1 MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60 MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD Sbjct: 1 MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60 Query: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV Sbjct: 61 SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108 >gi|254780409|ref|YP_003064822.1| ribose-phosphate pyrophosphokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 310 Score = 21.2 bits (43), Expect = 4.5, Method: Compositional matrix adjust. Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Query: 78 DLELEVEIAENVRVRVVRSFVSEVQSKSEP 107 D E+ VEI ENVR V F+ VQS S P Sbjct: 34 DREVFVEIGENVRGEDV--FI--VQSTSCP 59 >gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 328 Score = 20.8 bits (42), Expect = 6.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 46 LQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDD 78 + R + L N+R+ V GI+G + +IDD Sbjct: 182 FEDRLQTLENVRKSGIKVCCGGILG-LGEMIDD 213 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.135 0.368 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,090 Number of Sequences: 1233 Number of extensions: 1729 Number of successful extensions: 8 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 6 length of query: 108 length of database: 328,796 effective HSP length: 62 effective length of query: 46 effective length of database: 252,350 effective search space: 11608100 effective search space used: 11608100 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 32 (16.9 bits)