>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=98.72 E-value=1e-07 Score=69.90 Aligned_cols=72 Identities=25% Similarity=0.366 Sum_probs=63.9 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) T Consensus 97 LSgGq~Qri~lARal~----~~p~illlDEpts~LD~~~~~~i~~~l~~~~~~~Tvi~vtH~~~~~~~~D~v~~l~ 168 (171) T cd03228 97 LSGGQRQRIAIARALL----RDPPILILDEATSALDPETEALILEALRALAKGKTVIVIAHRLSTIRDADRIIVLD 168 (171) T ss_pred CCHHHHHHHHHHHHHH----HCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHCCEEEEEE T ss_conf 4488999999999997----48998999577667998999999999999809998999957999997099999981

HHsearch alignment for GI: 255764514 and conserved domain: cd03228