>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=97.96 E-value=9.3e-05 Score=50.33 Aligned_cols=72 Identities=32% Similarity=0.378 Sum_probs=59.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-17617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) T Consensus 101 LSGGq~QRvaIARAL~----~~P~ill~DEPts~LD~~~~~~i~~~l~~l~~~~~~t~i~vTHd~~~a~~~aDri~vm~ 175 (178) T cd03229 101 LSGGQQQRVALARALA----MDPDVLLLDEPTSALDPITRREVRALLKSLQAQLGITVVLVTHDLDEAARLADRVVVLR 175 (178) T ss_pred CCCHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 7726889999999985----29999997089764799999999999999999649999999899999998699999992

HHsearch alignment for GI: 255764514 and conserved domain: cd03229