>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

Probab=98.05 E-value=4.3e-05 Score=52.51 Aligned_cols=72 Identities=25% Similarity=0.274 Sum_probs=58.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCEEEEECHHHHHH-HCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730-593999808379865-017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSK-KIQLLAVTHAPQVAA-RADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~-~~Qvi~ITH~pqvAa-~a~~h~~v~ 503 (554) T Consensus 140 LSGGq~QRvaIAraL~----~~P~iLlLDEPTs~LD~~~~~~v~~li~~L~~~G~Tvi~vtHDl~~~~~laDrI~Vm~ 213 (255) T cd03236 140 LSGGELQRVAIAAALA----RDADFYFFDEPSSYLDIKQRLNAARLIRELAEDDNYVLVVEHDLAVLDYLSDYIHCLY 213 (255) T ss_pred CCHHHHHHHHHHHHHC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8999999999999736----8999999979876589999999999999999789999999078999998699899981

HHsearch alignment for GI: 255764514 and conserved domain: cd03236