>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.

Probab=99.96 E-value=2.9e-29 Score=211.86 Aligned_cols=79 Identities=27% Similarity=0.333 Sum_probs=75.5 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEECHHHHHHHCCCEEEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305-93999808379865017617999962 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK-IQLLAVTHAPQVAARADRHFLVYKTN 506 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~-~Qvi~ITH~pqvAa~a~~h~~v~K~~ 506 (554) T Consensus 95 LSGGEksl~alal~~ai~~~~p~p~~iLDEvdAaLD~~N~~r~~~~i~el~~~~sQfIiITH~~~~m~~ad~l~gVtm~~ 174 (178) T cd03239 95 LSGGEKSLSALALIFALQEIKPSPFYVLDEIDAALDPTNRRRVSDMIKEMAKHTSQFIVITLKKEMFENADKLIGVLFVH 174 (178) T ss_pred CCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEEECC T ss_conf 67525899999999999713899669982765547988999999999999738998999986899997478589998028

HHsearch alignment for GI: 255764514 and conserved domain: cd03239