>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.

Probab=98.56 E-value=6.8e-07 Score=64.41 Aligned_cols=72 Identities=22% Similarity=0.337 Sum_probs=63.0 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCEEEEE Q ss_conf 0621579999999998436689976998034468887999999999999730593999808379865017617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAARADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~a~~h~~v~ 503 (554) T Consensus 139 LSgGqkQRlalARall----~~~~illlDEpts~LD~~te~~i~~~l~~~~~~~Tvi~itHrl~~l~~aD~Iivl~ 210 (237) T cd03252 139 LSGGQRQRIAIARALI----HNPRILIFDEATSALDYESEHAIMRNMHDICAGRTVIIIAHRLSTVKNADRIIVME 210 (237) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCEEEEEE T ss_conf 8999999999999996----69999999486456898999999999999829999999807888998499999998

HHsearch alignment for GI: 255764514 and conserved domain: cd03252