>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.

Probab=98.32 E-value=3.2e-06 Score=59.97 Aligned_cols=73 Identities=33% Similarity=0.392 Sum_probs=61.2 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-176179999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLVYK 504 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v~K 504 (554) T Consensus 146 LSGGq~QRv~iAraL~----~~P~iLllDEPTs~LD~~~~~~i~~~l~~l~~~~~~tii~vtHd~~~~~~~aDrv~vm~~ 221 (228) T cd03257 146 LSGGQRQRVAIARALA----LNPKLLIADEPTSALDVSVQAQILDLLKKLQEELGLTLLFITHDLGVVAKIADRVAVMYA 221 (228) T ss_pred CCHHHHHHHHHHHHCC----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEEC T ss_conf 7988999999821104----799999994887647999999999999999985098999986899999996999999979

HHsearch alignment for GI: 255764514 and conserved domain: cd03257