>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=98.09 E-value=4.1e-05 Score=52.64 Aligned_cols=73 Identities=21% Similarity=0.233 Sum_probs=60.3 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 406215799999999984366899769980344688879999999999997305939998083798650-17617999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKIQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) T Consensus 130 ~LSgG~kqrv~ia~al~----~~P~lliLDEPt~gLDp~~~~~~~~ll~~l~~~~tii~stH~l~e~e~~~dri~il~ 203 (211) T cd03264 130 SLSGGMRRRVGIAQALV----GDPSILIVDEPTAGLDPEERIRFRNLLSELGEDRIVILSTHIVEDVESLCNQVAVLN 203 (211) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 58988999999999982----899999994897678999999999999997299899998998899999699999998

HHsearch alignment for GI: 255764514 and conserved domain: cd03264