>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=97.87 E-value=0.00018 Score=48.45 Aligned_cols=74 Identities=20% Similarity=0.233 Sum_probs=59.8 Q ss_pred HHCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECHHHHHHHCCCEEEEEE Q ss_conf 4062157999999999843668997699803446888799999999999973059--39998083798650176179999 Q gi|255764514|r 427 LASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKKI--QLLAVTHAPQVAARADRHFLVYK 504 (554) Q Consensus 427 iaSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~~--Qvi~ITH~pqvAa~a~~h~~v~K 504 (554) T Consensus 131 ~LS~G~kqrv~ia~Al~----~~P~lliLDEPt~gLDp~~~~~i~~~i~~l~~~~g~tiilssH~l~eve~l~dri~il~ 206 (220) T cd03265 131 TYSGGMRRRLEIARSLV----HRPEVLFLDEPTIGLDPQTRAHVWEYIEKLKEEFGMTILLTTHYMEEAEQLCDRVAIID 206 (220) T ss_pred HCCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 47999999999999985----69998998088668899999999999999998389799998888899998699999997

HHsearch alignment for GI: 255764514 and conserved domain: cd03265