>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=98.10 E-value=3.1e-05 Score=53.50 Aligned_cols=72 Identities=32% Similarity=0.403 Sum_probs=59.4 Q ss_pred HCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEECHHHHHHH-CCCEEEEE Q ss_conf 06215799999999984366899769980344688879999999999997305--939998083798650-17617999 Q gi|255764514|r 428 ASGGELSRFLLALKIVLVDQGSIPTLVFDEVDSGIGGAVADAIGYRLKQLSKK--IQLLAVTHAPQVAAR-ADRHFLVY 503 (554) Q Consensus 428 aSGGE~Sr~~LAl~~~~~~~~~~p~~ifDEiDagi~G~~a~~v~~~l~~ls~~--~Qvi~ITH~pqvAa~-a~~h~~v~ 503 (554) T Consensus 129 LSGGqkQRvaiARAL~----~~P~ilLlDEPts~LD~~~~~~l~~~l~~l~~~~~~Tvi~vTHd~~ea~~~adriivl~ 203 (211) T cd03298 129 LSGGERQRVALARVLV----RDKPVLLLDEPFAALDPALRAEMLDLVLDLHAETKMTVLMVTHQPEDAKRLAQRVVFLD 203 (211) T ss_pred CCHHHHHHHHHHHHHH----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCEEEEEE T ss_conf 8989999999999986----59999997188765598999999999999999749989999889999999699999998

HHsearch alignment for GI: 255764514 and conserved domain: cd03298