HHsearch alignment for GI: 255764515 and conserved domain: CHL00122

>CHL00122 secA preprotein translocase subunit SecA; Validated.
Probab=98.49  E-value=8.5e-05  Score=47.30  Aligned_cols=124  Identities=19%  Similarity=0.337  Sum_probs=70.9

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
T Consensus        73 lg~r~~dvQl~gg~~Lh~G~iaEM~TGEGKTL~atlp-~ylnal~GkgvhvvTvNdYLA~RDae~m~~vy~~l---Glsv  148 (891)
T CHL00122         73 LGLRHFDVQLIGGLVLNDGKIAEMKTGEGKTLVATLP-AYLNALTGKGVHIVTVNDYLARRDSEWMGQIYRFL---GLSV  148 (891)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             4897646999989998459524650688579999999-99997559972998064565686699999999982---9667


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
T Consensus       149 g~i~~~~~~~er~~aY~~D-ItY~Tn~e~gFDyLRDnm~~~~~~~vqr~~~~aIvDEvDSi  208 (891)
T CHL00122        149 GLIQEDMSIEERKQNYKAD-ITYVTNSELGFDYLRDNMALSLSEVVQRPFNYCIIDEVDSI  208 (891)
T ss_pred             EEECCCCCHHHHHHHHCCC-CEEECCCCEECCCCCCCCCCCHHHHHCCCCCEEEEECHHHH
T ss_conf             0208999979999983589-27978876222566633236878840889973788640455