HHsearch alignment for GI: 255764515 and conserved domain: CHL00195

>CHL00195 ycf46 Ycf46; Provisional.
Probab=91.37  E-value=0.36  Score=25.34  Aligned_cols=44  Identities=23%  Similarity=0.114  Sum_probs=22.5

Q ss_pred             HHHHCCCCCCEEEEEHHHCCCCCC--CCCC--CCEEEEECCCCCHHHH
Q ss_conf             764245885589984422111622--0017--8599990899898686
Q gi|255764515|r  354 IQEWNEGKIPLLFAHPASCGHGLN--LQYG--GNILVFFSLWWDLEEH  397 (458)
Q Consensus       354 i~~f~~~~~~vli~s~~~~~~Gln--L~~a--~~~iI~~~~~wn~~~~  397 (458)
T Consensus       351 Lt~m~e~~~~VfViattN~~~~L~pellR~GRFD~~~~v~lP~~~~R~  398 (491)
T CHL00195        351 ITWLSEKKSPVFVVATANNIDSLPLELLRKGRFDEIFFLDLPNLEERE  398 (491)
T ss_pred             HHHHCCCCCCEEEEEECCCCCCCCHHHCCCCCCCEEEECCCCCHHHHH
T ss_conf             998646899769999589975589877089877704764895989999