HHsearch alignment for GI: 255764515 and conserved domain: COG0513

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].
Probab=99.90  E-value=6.1e-20  Score=139.04  Aligned_cols=324  Identities=17%  Similarity=0.236  Sum_probs=200.6

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHH--CCCCC-EEEEECCHHHHHHHHHHHHHHCCCC-CCE
Q ss_conf             874789999999996798099958899868999-999999997--59994-9999160465699999999855888-815
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHL--WGEKS-VLVIAPLRVAQSVWTSEVQRWSNFS-HMN   76 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~--~~~~~-~LIv~P~~l~~~~W~~Ei~kf~~~~-~~~   76 (458)
T Consensus        51 ~pt~IQ~~~iP~~l~g~Dvi~~A~TGsGKT~Af~lP~l~~i~~~~~~~~~~aLil~PTRELA~Qi~~~~~~~~~~~~~~~  130 (513)
T COG0513          51 EPTPIQLAAIPLILAGRDVLGQAQTGTGKTAAFLLPLLQKILKSVERKYVSALILAPTRELAVQIAEELRKLGKNLGGLR  130 (513)
T ss_pred             CCCHHHHHHCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             98989996587763699979986898717899999999997400455777569977999999999999999986245842


Q ss_pred             EEEEECC-H-HHHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             9998589-7-8988873077986998064202334420-00113220440453100246543115677776654305980
Q gi|255764515|r   77 ISVITGT-V-KQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESER  153 (458)
Q Consensus        77 ~~~~~g~-~-~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~  153 (458)
T Consensus       131 ~~~i~GG~~~~~q~~~l~~g~~ivVaTPGRllD~i~~~~l~l~~v~~lVlDEADrmld~gf---~~~i~~I~~~~p~~~q  207 (513)
T COG0513         131 VAVVYGGVSIRKQIEALKRGVDIVVATPGRLLDLIKRGKLDLSGVETLVLDEADRMLDMGF---IDDIEKILKALPPDRQ  207 (513)
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCHHHHHHHCCCCCCCCEEEEEECCHHHHCCCCC---HHHHHHHHHHCCCCCE
T ss_conf             9999899898999998724998999796089999864885546501899676176638876---8999999973897748


Q ss_pred             EEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             79965840231001013467751788877532778877736956403300002455554558999997424543320000
Q gi|255764515|r  154 FIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD  233 (458)
Q Consensus       154 ~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~  233 (458)
T Consensus       208 tllfSAT~~~-~i--------------------~~l~~~~l~~---------------------------p~~i~v~~~~  239 (513)
T COG0513         208 TLLFSATMPD-DI--------------------RELARRYLND---------------------------PVEIEVSVEK  239 (513)
T ss_pred             EEEEEECCCH-HH--------------------HHHHHHHCCC---------------------------CCEEEECCCC
T ss_conf             9999824898-99--------------------9999997368---------------------------8079964322


Q ss_pred             CCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHH
Q ss_conf             10010011000345245368998889999998510334520223478888754203541000223430001343333256
Q gi|255764515|r  234 YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE  313 (458)
Q Consensus       234 ~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~  313 (458)
T Consensus       240 ~~~-~~~~i~q~~~~v~-----------------------------------------------------~~~~k~~~L~  265 (513)
T COG0513         240 LER-TLKKIKQFYLEVE-----------------------------------------------------SEEEKLELLL  265 (513)
T ss_pred             CCC-CCCCCEEEEEEEC-----------------------------------------------------CHHHHHHHHH
T ss_conf             335-3004707999808-----------------------------------------------------5677999999


Q ss_pred             HHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCC
Q ss_conf             65412488403422236788866410----------00265334458998764245885589984422111622001785
Q gi|255764515|r  314 VIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN  383 (458)
Q Consensus       314 ~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~  383 (458)
T Consensus       266 ~ll~~~~~~~~IVF~~tk~~~~~l~~~l~~~g~~~~~lhG~l~q~~R~~~l~~F~~g~~~iLVaT-DvaaRGiDi~~-v~  343 (513)
T COG0513         266 KLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLVAT-DVAARGLDIPD-VS  343 (513)
T ss_pred             HHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCEEEEE-CHHHCCCCCCC-CC
T ss_conf             99827888839999576776999999999789659997388998899999999975998989980-65446899666-74


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             999908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       384 ~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
T Consensus       344 ~VinyD~p~~~e~yvHRiGRTg-----RaG~~--G~ai~fv~~-~~e~~~l~~i~~~  392 (513)
T COG0513         344 HVINYDLPLDPEDYVHRIGRTG-----RAGRK--GVAISFVTE-EEEVKKLKRIEKR  392 (513)
T ss_pred             EEEECCCCCCCCCCCCCCCCCC-----CCCCC--CEEEEEECC-HHHHHHHHHHHHH
T ss_conf             7997879998041317345343-----48998--727998556-2349999999998