HHsearch alignment for GI: 255764515 and conserved domain: COG0610

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].
Probab=99.51  E-value=7.9e-13  Score=95.96  Aligned_cols=139  Identities=19%  Similarity=0.251  Sum_probs=93.2

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHC-CCC
Q ss_conf             980999588998689999999999975-999499991604656999999998558888159998589789888730-779
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLW-GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPA   95 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~-~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~-~~~   95 (458)
T Consensus       274 ~~G~IWHtqGSGKTltm~~~A~~l~~~~~~~~v~fvvDR~dLd~Q~~~~f~~~~~~~~~~~--~~~s~~~Lk~~l~~~~~  351 (962)
T COG0610         274 KGGYIWHTQGSGKTLTMFKLARLLLELPKNPKVLFVVDRKDLDDQTSDEFQSFGKVAFNDP--KAESTSELKELLEDGKG  351 (962)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHCCCC
T ss_conf             7238984069837899999999998365999699996728899999999999887632044--44579999999865898


Q ss_pred             CEEEECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHH
Q ss_conf             86998064202334420---00113220440453100246543115677776654305980799658402310
Q gi|255764515|r   96 VLYVINFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNG  165 (458)
Q Consensus        96 ~i~i~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~  165 (458)
T Consensus       352 ~ii~TTIQKf~~~~~~~~~~~~~~~~ivvI~DEaHRSQ------~G~~~~~~~~~~~~-a~~~gFTGTPi~~~  417 (962)
T COG0610         352 KIIVTTIQKFNKAVKEDELELLKRKNVVVIIDEAHRSQ------YGELAKLLKKALKK-AIFIGFTGTPIFKE  417 (962)
T ss_pred             CEEEEEECCCCHHHHCCCCCCCCCCCEEEEEECCCCCC------CHHHHHHHHHHHCC-CEEEEEECCCCCCC
T ss_conf             48999710264333333200047876799986401035------60789999987036-70897517856402