HHsearch alignment for GI: 255764515 and conserved domain: COG1202

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only].
Probab=99.79  E-value=4e-17  Score=121.95  Aligned_cols=312  Identities=17%  Similarity=0.216  Sum_probs=177.3

Q ss_pred             CCCHHHHHHHHH-HHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             874789999999-996798099958899868999-999999997599949999160465699999999855888815999
Q gi|255764515|r    2 NLAPHQTKIVDW-ILDHKRCAIWASMGSGKTVSV-LTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         2 ~L~p~Q~~~v~~-~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
T Consensus       216 eLlPVQ~laVe~GLLeG~nllVVSaTasGKTLIgElAGi~~~l-~~g~KmlfLvPLVALANQKy~dF~~rYs~Lglkvai  294 (830)
T COG1202         216 ELLPVQVLAVEAGLLEGENLLVVSATASGKTLIGELAGIPRLL-SGGKKMLFLVPLVALANQKYEDFKERYSKLGLKVAI  294 (830)
T ss_pred             EECCHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHCCHHHH-HCCCEEEEEEHHHHHHCCHHHHHHHHHHCCCCEEEE
T ss_conf             4302346556614405773499940577751477763738788-378728997316876311189999986501662788


Q ss_pred             EECCHHHHHH------HHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCC-CCCCHHHHHHHHHHHHHCCC
Q ss_conf             8589789888------7307798699806420233442000113220440453100246-54311567777665430598
Q gi|255764515|r   80 ITGTVKQRTK------VLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSF-RLRQGSKTARALAKPAWESE  152 (458)
Q Consensus        80 ~~g~~~~r~~------~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~-~~~~~s~~~~~l~~~~~~~~  152 (458)
T Consensus       295 rVG~srIk~~~~pv~~~t~~dADIIVGTYEGiD~lLRtg~~lgdiGtVVIDEiHtL~deERG~RLdGLI~RLr~l~~~A-  373 (830)
T COG1202         295 RVGMSRIKTREEPVVVDTSPDADIIVGTYEGIDYLLRTGKDLGDIGTVVIDEIHTLEDEERGPRLDGLIGRLRYLFPGA-  373 (830)
T ss_pred             EECHHHHCCCCCCCCCCCCCCCCEEEEECHHHHHHHHCCCCCCCCCEEEEEEEEECCCHHCCCCHHHHHHHHHHHCCCC-
T ss_conf             8423452246775356899877679861110789987078555443599650120440101632352899999867777-


Q ss_pred             EEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             07996584023100101346775178887753277887773695640330000245555455899999742454332000
Q gi|255764515|r  153 RFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIA  232 (458)
Q Consensus       153 ~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~  232 (458)
T Consensus       374 Q~i~LSATV--gNp~elA~~l~a------------------------------------------------------~lV  397 (830)
T COG1202         374 QFIYLSATV--GNPEELAKKLGA------------------------------------------------------KLV  397 (830)
T ss_pred             EEEEEEEEC--CCHHHHHHHHCC------------------------------------------------------EEE
T ss_conf             499987433--886999988387------------------------------------------------------258


Q ss_pred             CCCCCCCCCEEEEEEECCHHH-HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCC
Q ss_conf             010010011000345245368-9988899999985103345202234788887542035410002234300013433332
Q gi|255764515|r  233 DYQNIDKPILITKKVPLPQPV-MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKA  311 (458)
Q Consensus       233 ~~~~l~~~~~~~~~v~l~~~~-~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~  311 (458)
T Consensus       398 ~y~~RPVplErHlvf~~~e~eK~~ii~~L~k~E~~---------------------------------------------  432 (830)
T COG1202         398 LYDERPVPLERHLVFARNESEKWDIIARLVKREFS---------------------------------------------  432 (830)
T ss_pred             EECCCCCCHHHEEEEECCCHHHHHHHHHHHHHHHH---------------------------------------------
T ss_conf             65588787367066404816777899999999975---------------------------------------------


Q ss_pred             HHHHHHCCCCCEEEEHHHHHHHHHHHH----------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCC
Q ss_conf             566541248840342223678886641----------0002653344589987642458855899844221116220017
Q gi|255764515|r  312 LEVIIEKANAAPIIVAYHFNSDLARLQ----------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYG  381 (458)
Q Consensus       312 l~~il~~~~~~kviif~~~~~~~~~i~----------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a  381 (458)
T Consensus       433 -~~-sskg~rGQtIVFT~SRrr~h~lA~~L~~kG~~a~pYHaGL~y~eRk~vE~~F~~q~l~~VV-TTAAL~AGVDFP-A  508 (830)
T COG1202         433 -TE-SSKGYRGQTIVFTYSRRRCHELADALTGKGLKAAPYHAGLPYKERKSVERAFAAQELAAVV-TTAALAAGVDFP-A  508 (830)
T ss_pred             -HH-HCCCCCCCEEEEECCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEE-EHHHHHCCCCCC-H
T ss_conf             -44-1137677369994216669999988610786665443798678888899997608755576-424564478875-1


Q ss_pred             CCEEEEE----CC-CCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEEC
Q ss_conf             8599990----89-989868644566662022020378775289999858
Q gi|255764515|r  382 GNILVFF----SL-WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ  426 (458)
Q Consensus       382 ~~~iI~~----~~-~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~  426 (458)
T Consensus       509 -SQVIFEsLaMG~~WLs~~EF~QM~GRAGRp~yHd-----rGkVyllvep  552 (830)
T COG1202         509 -SQVIFESLAMGIEWLSVREFQQMLGRAGRPDYHD-----RGKVYLLVEP  552 (830)
T ss_pred             -HHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCC-----CCEEEEEECC
T ss_conf             -8999999871043278999999850469987233-----7339999557