HHsearch alignment for GI: 255764515 and conserved domain: COG1474

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones].
Probab=95.54  E-value=0.06  Score=30.04  Aligned_cols=45  Identities=16%  Similarity=0.198  Sum_probs=29.4

Q ss_pred             CHHHHHHHHHHH----HC---CCEEEEECCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             478999999999----67---9809995889986899999999999759994
Q gi|255764515|r    4 APHQTKIVDWIL----DH---KRCAIWASMGSGKTVSVLTALSYIHLWGEKS   48 (458)
Q Consensus         4 ~p~Q~~~v~~~~----~~---~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~   48 (458)
T Consensus        22 Re~ei~~l~~~l~~~~~~~~p~n~~iyG~~GTGKT~~~~~v~~~l~~~~~~~   73 (366)
T COG1474          22 REEEINQLASFLAPALRGERPSNIIIYGPTGTGKTATVKFVMEELEESSANV   73 (366)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             4889999999999985589986079988999873289999999997331567