HHsearch alignment for GI: 255764515 and conserved domain: COG3973

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only].
Probab=91.26  E-value=0.59  Score=24.03  Aligned_cols=45  Identities=33%  Similarity=0.421  Sum_probs=30.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCC-----CCCEEEEECCHHHHHHHHHH
Q ss_conf             09995889986899999999999759-----99499991604656999999
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWG-----EKSVLVIAPLRVAQSVWTSE   65 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~-----~~~~LIv~P~~l~~~~W~~E   65 (458)
T Consensus       229 lVVQGaAGSGKTtiALHRvAyLlY~~R~~l~~k~vlvl~PN~vFl-eYis~  278 (747)
T COG3973         229 LVVQGAAGSGKTTIALHRVAYLLYGYRGPLQAKPVLVLGPNRVFL-EYISR  278 (747)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEECCCHHHH-HHHHH
T ss_conf             899558888713588999999985356624668659982838999-99987