HHsearch alignment for GI: 255764515 and conserved domain: COG4889

>COG4889 Predicted helicase [General function prediction only].
Probab=99.84  E-value=1.7e-19  Score=136.37  Aligned_cols=154  Identities=16%  Similarity=0.252  Sum_probs=93.1

Q ss_pred             CCCHHHHHHHHHHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCE
Q ss_conf             874789999999996----798099958899868999999999997599949999160-465699999999855888815
Q gi|255764515|r    2 NLAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMN   76 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~   76 (458)
T Consensus       161 k~R~hQq~Aid~a~~~F~~n~RGkLIMAcGTGKTfTsLkisEala~---~~iL~LvPSIsLLs-QT---lrew~~~~~l~  233 (1518)
T COG4889         161 KPRPHQQTAIDAAKEGFSDNDRGKLIMACGTGKTFTSLKISEALAA---ARILFLVPSISLLS-QT---LREWTAQKELD  233 (1518)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHHH---HHEEEECCHHHHHH-HH---HHHHHHCCCCC
T ss_conf             9983678999999862551667758983378862137889999864---02365435189999-99---99885346655


Q ss_pred             EE---EEECCHHH------------------HHH--------HHCCCCCEEEECCCCHHHHHHHCC-CCCCCCEEECCCC
Q ss_conf             99---98589789------------------888--------730779869980642023344200-0113220440453
Q gi|255764515|r   77 IS---VITGTVKQ------------------RTK--------VLKTPAVLYVINFENLGWLVQELK-GTWPFATIVVDES  126 (458)
Q Consensus        77 ~~---~~~g~~~~------------------r~~--------~~~~~~~i~i~s~e~~~~~~~~~~-~~~~~~~iIiDEa  126 (458)
T Consensus       234 ~~a~aVcSD~kvsrs~eDik~sdl~~p~sT~~~~il~~~~~~~k~~~~~vvFsTYQSl~~i~eAQe~G~~~fDliicDEA  313 (1518)
T COG4889         234 FRASAVCSDDKVSRSAEDIKASDLPIPVSTDLEDILSEMEHRQKANGLTVVFSTYQSLPRIKEAQEAGLDEFDLIICDEA  313 (1518)
T ss_pred             CEEEEEECCCCCCCCCCCCCHHCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCCEEEECCH
T ss_conf             12578863652344412321204788875749999999987533378389997021148789999749997537974400


Q ss_pred             CCCCCCC--CCCHHHHHHHHHHHHHCCCEEEEECCCCH
Q ss_conf             1002465--43115677776654305980799658402
Q gi|255764515|r  127 TKLKSFR--LRQGSKTARALAKPAWESERFIELTGTPS  162 (458)
Q Consensus       127 H~lkn~~--~~~~s~~~~~l~~~~~~~~~~l~LTgTPi  162 (458)
T Consensus       314 HRTtGa~~a~dd~saFt~vHs~~niKa~kRlYmTATPk  351 (1518)
T COG4889         314 HRTTGATLAGDDKSAFTRVHSDQNIKAAKRLYMTATPK  351 (1518)
T ss_pred             HCCCCCEECCCCCCCCEEECCCCCHHHHHHHHCCCCCH
T ss_conf             01446232257720104533764158887666006860