HHsearch alignment for GI: 255764515 and conserved domain: KOG0326

>KOG0326 consensus.
Probab=99.46  E-value=8.3e-13  Score=95.83  Aligned_cols=313  Identities=19%  Similarity=0.227  Sum_probs=168.4

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC-CCCCEEEEECCH---HHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             789999999996798099958899868999-9999999975-999499991604---65699999999855888815999
Q gi|255764515|r    5 PHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW-GEKSVLVIAPLR---VAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         5 p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~-~~~~~LIv~P~~---l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
T Consensus       110 PiQeesIPiaLtGrdiLaRaKNGTGKT~a~~IP~Lekid~~~~~IQ~~ilVPtrelALQtSqvc~~lskh~---~i~vmv  186 (459)
T KOG0326         110 PIQEESIPIALTGRDILARAKNGTGKTAAYCIPVLEKIDPKKNVIQAIILVPTRELALQTSQVCKELSKHL---GIKVMV  186 (459)
T ss_pred             CCCCCCCCEEECCHHHHHHCCCCCCCCCCEECHHHHHCCCCCCCEEEEEEEECCHHHHHHHHHHHHHHCCC---CEEEEE
T ss_conf             75302354442351355550189887330441256652822100447999616326678879999986046---849999


Q ss_pred             EECCHHHHHHHHC--CCCCEEEECCCCHHHHHHHCCC-CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             8589789888730--7798699806420233442000-113220440453100246543115677776654305980799
Q gi|255764515|r   80 ITGTVKQRTKVLK--TPAVLYVINFENLGWLVQELKG-TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIE  156 (458)
Q Consensus        80 ~~g~~~~r~~~~~--~~~~i~i~s~e~~~~~~~~~~~-~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~  156 (458)
T Consensus       187 ttGGT~lrDDI~Rl~~~VH~~vgTPGRIlDL~~KgVa~ls~c~~lV~DEADKlLs~~F---~~~~e~li~~lP~~rQill  263 (459)
T KOG0326         187 TTGGTSLRDDIMRLNQTVHLVVGTPGRILDLAKKGVADLSDCVILVMDEADKLLSVDF---QPIVEKLISFLPKERQILL  263 (459)
T ss_pred             ECCCCCCCCCEEEECCCEEEEECCCHHHHHHHHCCCCCCHHCEEEEECHHHHHHCHHH---HHHHHHHHHHCCCCCEEEE
T ss_conf             4388654432056158269997287178888862652200114787410554414145---6789999875785420467


Q ss_pred             ECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             65840231001013467751788877532778877736956403300002455554558999997424543320000100
Q gi|255764515|r  157 LTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN  236 (458)
Q Consensus       157 LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~  236 (458)
T Consensus       264 ySAT-FP~--------------------tVk~Fm~~~l~kP---------------------------------------  283 (459)
T KOG0326         264 YSAT-FPL--------------------TVKGFMDRHLKKP---------------------------------------  283 (459)
T ss_pred             EECC-CCH--------------------HHHHHHHHHCCCC---------------------------------------
T ss_conf             6313-640--------------------5888999860586---------------------------------------


Q ss_pred             CCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHH
Q ss_conf             10011000345245368998889999998510334520223478888754203541000223430001343333256654
Q gi|255764515|r  237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVII  316 (458)
Q Consensus       237 l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il  316 (458)
T Consensus       284 ----y~INLM~eLtl~GvtQyYaf------------------------------------------V~e~qKvhCLntLf  317 (459)
T KOG0326         284 ----YEINLMEELTLKGVTQYYAF------------------------------------------VEERQKVHCLNTLF  317 (459)
T ss_pred             ----CEEEHHHHHHHCCHHHHEEE------------------------------------------ECHHHHHHHHHHHH
T ss_conf             ----02204656320352321011------------------------------------------02355556499898


Q ss_pred             HCCCCCEEEEHHHHHHHHHHHHHCCC----------CCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEE
Q ss_conf             12488403422236788866410002----------65334458998764245885589984422111622001785999
Q gi|255764515|r  317 EKANAAPIIVAYHFNSDLARLQKAFP----------QGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILV  386 (458)
Q Consensus       317 ~~~~~~kviif~~~~~~~~~i~~~~~----------~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI  386 (458)
T Consensus       318 skLqINQsIIFCNS~~rVELLAkKITelGyscyyiHakM~Q~hRNrVFHdFr~G~crnLVct-DL~TRGIDiq-avNvVI  395 (459)
T KOG0326         318 SKLQINQSIIFCNSTNRVELLAKKITELGYSCYYIHAKMAQEHRNRVFHDFRNGKCRNLVCT-DLFTRGIDIQ-AVNVVI  395 (459)
T ss_pred             HHHCCCCEEEEECCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEH-HHHHCCCCCC-EEEEEE
T ss_conf             87500445999636317679898888616436677888877654245565432532012420-2330465541-025999


Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  387 FFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       387 ~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
T Consensus       396 NFDfpk~aEtYLHRIGRs-----GRFGh--lGlAInLitye--drf~L~~IE~e  440 (459)
T KOG0326         396 NFDFPKNAETYLHRIGRS-----GRFGH--LGLAINLITYE--DRFNLYRIEQE  440 (459)
T ss_pred             ECCCCCCHHHHHHHCCCC-----CCCCC--CCEEEEEEEHH--HHHHHHHHHHH
T ss_conf             637887778999871677-----65787--62479987503--24438899998