HHsearch alignment for GI: 255764515 and conserved domain: KOG0329

>KOG0329 consensus.
Probab=98.27  E-value=2.3e-05  Score=50.69  Aligned_cols=134  Identities=22%  Similarity=0.252  Sum_probs=81.4

Q ss_pred             CCCCCHHHHH-HHHHHHHH-HCCCCCEEEEECCHHHHHHHHHHHHHHCC-CCCCEEEEEECC--HHHHHHHHCCCCCEEE
Q ss_conf             8899868999-99999999-75999499991604656999999998558-888159998589--7898887307798699
Q gi|255764515|r   25 SMGSGKTVSV-LTALSYIH-LWGEKSVLVIAPLRVAQSVWTSEVQRWSN-FSHMNISVITGT--VKQRTKVLKTPAVLYV   99 (458)
Q Consensus        25 ~~G~GKT~~a-l~~~~~l~-~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~-~~~~~~~~~~g~--~~~r~~~~~~~~~i~i   99 (458)
T Consensus        87 ksgmgktavfvl~tlqqiepv~g~vsvlvmchtrelafqi~~ey~rfskymP~vkvaVFfGG~~Ikkdee~lk~~PhivV  166 (387)
T KOG0329          87 KSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLFIKKDEELLKNCPHIVV  166 (387)
T ss_pred             CCCCCCEEEEEHHHHHHCCCCCCEEEEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEECCEECCCCHHHHHCCCEEEE
T ss_conf             25788436552223552378898079999962189999988999999754888458999755310346998827990897


Q ss_pred             ECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             8064202334420-001132204404531002465431156777766543059807996584
Q gi|255764515|r  100 INFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
T Consensus       167 gTPGrilALvr~k~l~lk~vkhFvlDEcdkmle~l--DMrRDvQEifr~tp~~KQvmmfsat  226 (387)
T KOG0329         167 GTPGRILALVRNRSLNLKNVKHFVLDECDKMLEQL--DMRRDVQEIFRMTPHEKQVMMFSAT  226 (387)
T ss_pred             CCCHHHHHHHHHCCCCHHHCCEEEHHHHHHHHHHH--HHHHHHHHHHHCCCCCCEEEEEEEE
T ss_conf             68288999987245753203211233377899987--8888799986328653203454201