HHsearch alignment for GI: 255764515 and conserved domain: KOG0341

>KOG0341 consensus.
Probab=99.47  E-value=7.8e-13  Score=96.00  Aligned_cols=118  Identities=19%  Similarity=0.303  Sum_probs=85.8

Q ss_pred             CCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCC
Q ss_conf             333325665412488403422236788866410----------0026533445899876424588558998442211162
Q gi|255764515|r  307 EKIKALEVIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGL  376 (458)
Q Consensus       307 ~k~~~l~~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~Gl  376 (458)
T Consensus       408 aKiVylLeCLQKT-~PpVLIFaEkK~DVD~IhEYLLlKGVEavaIHGGKDQedR~~ai~afr~gkKDVLVAT-DVASKGL  485 (610)
T KOG0341         408 AKIVYLLECLQKT-SPPVLIFAEKKADVDDIHEYLLLKGVEAVAIHGGKDQEDRHYAIEAFRAGKKDVLVAT-DVASKGL  485 (610)
T ss_pred             HHHHHHHHHHCCC-CCCEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCEEEEE-CCHHCCC
T ss_conf             0120699876127-9966998414567478999998725136874168656678889999865787458873-1000368


Q ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHH
Q ss_conf             2001785999908998986864456666202202037877528999985899689999
Q gi|255764515|r  377 NLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL  434 (458)
Q Consensus       377 nL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~  434 (458)
T Consensus       486 DFp~i-qHVINyDMP~eIENYVHRIGRT-----GRsg~~--GiATTfINK~~~esvLl  535 (610)
T KOG0341         486 DFPDI-QHVINYDMPEEIENYVHRIGRT-----GRSGKT--GIATTFINKNQEESVLL  535 (610)
T ss_pred             CCCCC-HHHCCCCCHHHHHHHHHHHCCC-----CCCCCC--CEEEEEECCCCHHHHHH
T ss_conf             97450-4440478808899999971246-----778886--40222114563188898