HHsearch alignment for GI: 255764515 and conserved domain: KOG0350

>KOG0350 consensus.
Probab=99.78  E-value=1.2e-16  Score=119.15  Aligned_cols=352  Identities=17%  Similarity=0.203  Sum_probs=187.0

Q ss_pred             CCCHHHHHHHHHHHHC---------CCEEEEECCCCCHHHH-HHHHHHHHHHCCC--CCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             8747899999999967---------9809995889986899-9999999997599--94999916046569999999985
Q gi|255764515|r    2 NLAPHQTKIVDWILDH---------KRCAIWASMGSGKTVS-VLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRW   69 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~---------~~~ll~~~~G~GKT~~-al~~~~~l~~~~~--~~~LIv~P~~l~~~~W~~Ei~kf   69 (458)
T Consensus       159 ~~FPVQ~aVlp~ll~~~~~p~~~r~rDIcV~ApTGSGKTLaY~iPIVQ~L~~R~v~~LRavVivPtr~L~~QV~~~f~~~  238 (620)
T KOG0350         159 RLFPVQYAVLPSLLEEIRSPPPSRPRDICVNAPTGSGKTLAYVIPIVQLLSSRPVKRLRAVVIVPTRELALQVYDTFKRL  238 (620)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCEEEEHHHHHHHHCCCCCCCEEEEEEEEHHHHHHHHHHHHHHH
T ss_conf             54505888888999861479998877547755789884566513789997038734057999954799999999999985


Q ss_pred             CCCCCCEEEEEECCHHHHHHH--HC-CCC----CEEEECCCCHHHHHHHCCCCCCC-----CEEECCCCCCCCCCCCCCH
Q ss_conf             588881599985897898887--30-779----86998064202334420001132-----2044045310024654311
Q gi|255764515|r   70 SNFSHMNISVITGTVKQRTKV--LK-TPA----VLYVINFENLGWLVQELKGTWPF-----ATIVVDESTKLKSFRLRQG  137 (458)
Q Consensus        70 ~~~~~~~~~~~~g~~~~r~~~--~~-~~~----~i~i~s~e~~~~~~~~~~~~~~~-----~~iIiDEaH~lkn~~~~~~  137 (458)
T Consensus       239 ~~~tgL~V~~~sgq~sl~~E~~qL~~~~~~~~~DIlVaTPGRL---VDHl~~~k~f~Lk~LrfLVIDEADRll~------  309 (620)
T KOG0350         239 NSGTGLAVCSLSGQNSLEDEARQLASDPPECRIDILVATPGRL---VDHLNNTKSFDLKHLRFLVIDEADRLLD------  309 (620)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCCHHH---HHHCCCCCCCCHHHCEEEEECHHHHHHH------
T ss_conf             6688659886014540578999972599765436697372688---8860489875644535777525778999------


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCHH-HHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             56777766543059807996584023-10010134677517888775327788777369564033000024555545589
Q gi|255764515|r  138 SKTARALAKPAWESERFIELTGTPSP-NGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQK  216 (458)
Q Consensus       138 s~~~~~l~~~~~~~~~~l~LTgTPi~-n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~  216 (458)
T Consensus       310 -qsfQ~W------l~~v~~~~~~~k~~~~~~nii~~~~---~~--~pt~~~e~~t~~------~~~~~~l~kL~~satLs  371 (620)
T KOG0350         310 -QSFQEW------LDTVMSLCKTMKRVACLDNIIRQRQ---AP--QPTVLSELLTKL------GKLYPPLWKLVFSATLS  371 (620)
T ss_pred             -HHHHHH------HHHHHHHHCCCHHHCCHHHHHHHCC---CC--CCHHHHHHHHHC------CCCCCHHHHHHCCHHHH
T ss_conf             -999988------9999998377401047154441014---67--740058777412------77675267653013330


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99997424543320000100100110003452453689988899999985103345202234788887542035410002
Q gi|255764515|r  217 EIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD  296 (458)
Q Consensus       217 ~l~~~l~~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~  296 (458)
T Consensus       372 qdP~Kl~~l~l~----------~Prl--~~v~~~--~----------------~~ryslp~---~l------~-------  405 (620)
T KOG0350         372 QDPSKLKDLTLH----------IPRL--FHVSKP--L----------------IGRYSLPS---SL------S-------  405 (620)
T ss_pred             CCHHHHHHHHCC----------CCCE--EEEECC--C----------------CEEEECCH---HH------H-------
T ss_conf             496887653327----------9835--886225--4----------------32661575---54------2-------


Q ss_pred             CCCCCHHCCC--CCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHHC--------------CCCCCCHHHHHHHHHHHCCC
Q ss_conf             2343000134--3333256654124884034222367888664100--------------02653344589987642458
Q gi|255764515|r  297 EEKHWKEVHD--EKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA--------------FPQGRTLDKDPCTIQEWNEG  360 (458