HHsearch alignment for GI: 255764515 and conserved domain: KOG0351

>KOG0351 consensus.
Probab=99.61  E-value=5e-14  Score=103.23  Aligned_cols=298  Identities=17%  Similarity=0.221  Sum_probs=170.3

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160-4656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
T Consensus       264 ~FR~~Q~eaI~~~l~Gkd~fvlmpTG~GKSLCY--QlPA~l~~--gitvVISPL~SLm~DQ----v~~L-~~~~I~a~~L  334 (941)
T KOG0351         264 GFRPNQLEAINATLSGKDCFVLMPTGGGKSLCY--QLPALLLG--GVTVVISPLISLMQDQ----VTHL-SKKGIPACFL  334 (941)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEEEECCCCEEEEE--ECCCCCCC--CCEEEECCHHHHHHHH----HHHH-HHCCCCEEEC
T ss_conf             588439999999974884699953488625676--66610138--9369963389999999----9743-2148541323


Q ss_pred             ECC--HHHHHHHHC----C--CCCEEEECCCCHHHH---H---HHCCCCCCCCEEECCCCCCCCCCCCC-CHHHHHHHHH
Q ss_conf             589--789888730----7--798699806420233---4---42000113220440453100246543-1156777766
Q gi|255764515|r   81 TGT--VKQRTKVLK----T--PAVLYVINFENLGWL---V---QELKGTWPFATIVVDESTKLKSFRLR-QGSKTARALA  145 (458)
Q Consensus        81 ~g~--~~~r~~~~~----~--~~~i~i~s~e~~~~~---~---~~~~~~~~~~~iIiDEaH~lkn~~~~-~~s~~~~~l~  145 (458)
T Consensus       335 ~s~q~~~~~~~i~q~l~~~~~~ikilYvtPE~v~~~~~l~~~~~~L~~~~~lal~vIDEAHCVSqWgHdFRp--~Yk~l~  412 (941)
T KOG0351         335 SSIQTAAERLAILQKLANGNPIIKILYVTPEKVVASEGLLESLADLYARGLLALFVIDEAHCVSQWGHDFRP--SYKRLG  412 (941)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCEEEEEEECHHHHHCCCCHHHHHHHCCCCCEEEEEEECHHHHHHHHCCCCCH--HHHHHH
T ss_conf             565668889999999857887678999677886333215667875067870488872278876642233347--789999


Q ss_pred             HHHHCCC--EEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5430598--07996584023100101346775178887753277887773695640330000245555455899999742
Q gi|255764515|r  146 KPAWESE--RFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLS  223 (458)
Q Consensus       146 ~~~~~~~--~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~  223 (458)
T Consensus       413 ~l~~~~~~vP~iALTATAT~~v~~DIi~~L~l~~~~-~~~~s--------------------------------------  453 (941)
T KOG0351         413 LLRIRFPGVPFIALTATATERVREDVIRSLGLRNPE-LFKSS--------------------------------------  453 (941)
T ss_pred             HHHHHCCCCCEEEEEHHCCHHHHHHHHHHHCCCCCC-EECCC--------------------------------------
T ss_conf             998527899768753002088999999982788863-22256--------------------------------------


Q ss_pred             HHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH
Q ss_conf             45433200001001001100034524536899888999999851033452022347888875420354100022343000
Q gi|255764515|r  224 DCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE  303 (458)
Q Consensus       224 ~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~  303 (458)
T Consensus       454 -----------fn--R~N-L~yeV~~k~~--------------------~------------------------------  469 (941)
T KOG0351         454 -----------FN--RPN-LKYEVSPKTD--------------------K------------------------------  469 (941)
T ss_pred             -----------CC--CCC-CEEEEEECCC--------------------C------------------------------
T ss_conf             -----------79--988-5599985667--------------------5------------------------------


Q ss_pred             CCCCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHH----------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCC
Q ss_conf             13433332566541248840342223678886641----------00026533445899876424588558998442211
Q gi|255764515|r  304 VHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQ----------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG  373 (458)
Q Consensus       304 ~~~~k~~~l~~il~~~~~~kviif~~~~~~~~~i~----------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~  373 (458)
T Consensus       470 --~~~~~~~~~~~~~~~~~s~IIYC~sr~~ce~vs~~L~~~~~~a~~YHAGl~~~~R~~Vq~~w~~~~~~VivATV-AFG  546 (941)
T KOG0351         470 --DALLDILEESKLRHPDQSGIIYCLSRKECEQVSAVLRSLGKSAAFYHAGLPPKERETVQKAWMSDKIRVIVATV-AFG  546 (941)
T ss_pred             --CCHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHCHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEEE-ECC
T ss_conf             --31688988765128999837996882319999999987352057552678878889999998568870899985-224


Q ss_pred             CCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             1622001785999908998986864456666202202037877528999
Q gi|255764515|r  374 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       374 ~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
T Consensus       547 MGIdK~D-VR~ViH~~lPks~E~YYQE~GRA-----GRDG~~s~C~l~y  589 (941)
T KOG0351         547 MGIDKPD-VRFVIHYSLPKSFEGYYQEAGRA-----GRDGLPSSCVLLY  589 (941)
T ss_pred             CCCCCCC-EEEEEECCCCHHHHHHHHHCCCC-----CCCCCCCEEEEEC
T ss_conf             7877786-35999777861478888740336-----7678800267742