HHsearch alignment for GI: 255764515 and conserved domain: KOG0354

>KOG0354 consensus.
Probab=100.00  E-value=1.1e-32  Score=216.15  Aligned_cols=418  Identities=15%  Similarity=0.124  Sum_probs=221.3

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH-HHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             987478999999999679809995889986899999999-9997599949999160465699999999855888815999
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~-~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
T Consensus        61 ~~lR~YQ~eivq~AL-gkNtii~lPTG~GKTfIAa~Vm~nh~rw~p~~KiVF~aP~~pLv~QQ~a~~~~~~~-~-~~~T~  137 (746)
T KOG0354          61 LELRNYQEELVQPAL-GKNTIIALPTGSGKTFIAAVIMKNHFEWRPKGKVVFLAPTRPLVNQQIACFSIYLI-P-YSVTG  137 (746)
T ss_pred             CCCCHHHHHHHHHHH-CCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCC-C-CCCEE
T ss_conf             656078999867862-68769995359986104799999997237764389960771178888988762067-6-01045


Q ss_pred             EECC---HHHHHHHHCCCCCEEEECCCCHHHHHHH-CCCC-CCCCEEECCCCCCC-CCCCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             8589---7898887307798699806420233442-0001-13220440453100-246543115677776654305980
Q gi|255764515|r   80 ITGT---VKQRTKVLKTPAVLYVINFENLGWLVQE-LKGT-WPFATIVVDESTKL-KSFRLRQGSKTARALAKPAWESER  153 (458)
Q Consensus        80 ~~g~---~~~r~~~~~~~~~i~i~s~e~~~~~~~~-~~~~-~~~~~iIiDEaH~l-kn~~~~~~s~~~~~l~~~~~~~~~  153 (458)
T Consensus       138 ~l~~~~~~~~r~~i~-~s~~vff~TpQil~ndL~~~~~~~ls~fs~iv~DE~Hra~kn~---~Y~~Vmr~~l~~k~~~~q  213 (746)
T KOG0354         138 QLGDTVPRSNRGEIV-ASKRVFFRTPQILENDLKSGLHDELSDFSLIVFDECHRTSKNH---PYNNIMREYLDLKNQGNQ  213 (746)
T ss_pred             ECCCCCCCCCHHHHH-CCCCEEEECHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCC---CHHHHHHHHHHHHHCCCC
T ss_conf             505756887624531-0263589672763433254334545517999972224455566---179999999986514661


Q ss_pred             EEEECCCCHHHHCCCH----HHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7996584023100101----346775178887753277887773695640330000245555455899999742454332
Q gi|255764515|r  154 FIELTGTPSPNGLIDL----WGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL  229 (458)
Q Consensus       154 ~l~LTgTPi~n~~~el----~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~  229 (458)
T Consensus       214 ILgLTASpG-~~~~~v~~~I~~L~asldvr-----~~ssi~~~y~~lr~~~~i~v~~~~~-~~~~~~~f~~~i~p~l~~l  286 (746)
T KOG0354         214 ILGLTASPG-SKLEQVQNVIDNLCASLDVR-----TESSIKSNYEELREHVQIPVDLSLC-ERDIEDPFGMIIEPLLQQL  286 (746)
T ss_pred             EEEEECCCC-CCHHHHHHHHHHHHEECCCC-----HHHHHHHHHHHHHCCCCCCCCHHHH-HHHHHHHHHHHHHHHHHHH
T ss_conf             799855888-45899999998520332555-----0445654189872467524758876-4113436999999999999


Q ss_pred             HCCCCCCCCCCC-EEEE---------EEECCHHHH---HHHHHHH--HHHH-HH-CC-------CCCCHHHHHHHH----
Q ss_conf             000010010011-0003---------452453689---9888999--9998-51-03-------345202234788----
Q gi|255764515|r  230 DIADYQNIDKPI-LITK---------KVPLPQPVM---KQYHKFQ--RELY-CD-LQ-------GENIEAFNSASK----  281 (458)
Q Consensus       230 ~~~~~~~l~~~~-~~~~---------~v~l~~~~~---~~y~~~~--~~~~-~~-~~-------~~~~~~~~~~~~----  281 (458)
T Consensus       287 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~f~~~~~~~~~~~ll~~~gir~~~~l~~~~~f~~e~~~~k~~~~  366 (746)
T KOG0354         287 QEEGLIEISDKSTSYEQWVVQAEKAAAPNGPENQRNCFYALHLRKYNLALLISDGIRFVDALDYLEDFYEEVALKKYLKL  366 (746)
T ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             86385410243334444043300222368874320367899999878888763234037777655543000004678898


Q ss_pred             ---------HHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHH----CCCCCEEEEHHHHHHHHHHHHHCCC------
Q ss_conf             ---------887542035410002234300013433332566541----2488403422236788866410002------
Q gi|255764515|r  282 ---------TVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE----KANAAPIIVAYHFNSDLARLQKAFP------  342 (458)
Q Consensus       282 ---------~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~----~~~~~kviif~~~~~~~~~i~~~~~------  342 (458)
T Consensus       367 ~~e~~~~~~~~~~m~~~~~------l~~~~~~~npkle~l~~~l~e~f~~~~dsR~IIFve~R~sa~~l~~~l~~~~~~~  440 (746)
T KOG0354         367 ELEARLIRNFTENMNELEH------LSLDPPKENPKLEKLVEILVEQFEQNPDSRTIIFVETRESALALKKWLLQLHELG  440 (746)
T ss_pred             HHCCHHHHHHHHHHHHHHH------HHCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEHHHHHHHHHHHHHHHHHCC
T ss_conf             7422106778898876443------2027876684699999999998605988507999732889999999997540135


Q ss_pred             ---------------CCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCC
Q ss_conf             ---------------65334458998764245885589984422111622001785999908998986864456666202
Q gi|255764515|r  343 ---------------QGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVT  407 (458)
Q Consensus       343 ---------------~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~  407 (458)
T Consensus       441 ir~~~fiGq~~s~~~~gmtqk~Q~evl~~Fr~G~~NvLVAT-SV~EEGLDI~-ec~lVIcYd~~snpIrmIQrrGRg---  515 (746)
T KOG0354         441 IKAEIFIGQGKSTQSTGMTQKEQKEVLDKFRDGEINVLVAT-SVAEEGLDIG-ECNLVICYDYSSNPIRMVQRRGRG---  515 (746)
T ss_pred             CCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEE-CCHHCCCCCC-CCCEEEEECCCCCHHHHHHHHCCC---
T ss_conf             44021560354454444578999999999857980279981-0100467742-112899965776688999986310---


Q ss_pred             CCHHCCCCCCEEEEEEEECCCHHHHHHH-HHHHHHHHHHHHHHHH
Q ss_conf             2020378775289999858996899999-9999999999998554
Q gi|255764515|r  408 RQRQAGFKRAVFVYYLIAQNTIDELVLQ-RLRTKSTIQDLLLNAL  451 (458)
Q Consensus       408 r~hR~Gq~~~v~v~~li~~~tide~i~~-~~~~K~~~~~~~~~~~  451 (458)
T Consensus       516 R------a~ns~~vll~t--~~~~~~~E~~~~~~e~lm~~~i~~~  552 (746)
T KOG0354         516 R------ARNSKCVLLTT--GSEVIEFERNNLAKEKLMNQTISKI  552 (746)
T ss_pred             C------CCCCEEEEEEC--CHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             1------01876999972--5168899888876999999999888