HHsearch alignment for GI: 255764515 and conserved domain: KOG0387

>KOG0387 consensus.
Probab=100.00  E-value=0  Score=495.95  Aligned_cols=428  Identities=22%  Similarity=0.313  Sum_probs=332.5

Q ss_pred             CCCHHHHHHHHHHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHCC--CCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             874789999999996----79809995889986899999999999759--994999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWG--EKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al~~~~~l~~~~--~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
T Consensus       205 ~Lf~yQreGV~WL~~L~~q~~GGILgDeMGLGKTIQiisFLaaL~~S~k~~~paLIVCP~Tii~-qW~~E~~~w~--p~~  281 (923)
T KOG0387         205 KLFPYQREGVQWLWELYCQRAGGILGDEMGLGKTIQIISFLAALHHSGKLTKPALIVCPATIIH-QWMKEFQTWW--PPF  281 (923)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCHHHHH-HHHHHHHHHC--CCE
T ss_conf             8648889889999999732578762012357640158999998750243258659982488999-9999998747--653


Q ss_pred             EEEEEECCHH-----------HHHHHH----CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHH
Q ss_conf             5999858978-----------988873----0779869980642023344200011322044045310024654311567
Q gi|255764515|r   76 NISVITGTVK-----------QRTKVL----KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT  140 (458)
Q Consensus        76 ~~~~~~g~~~-----------~r~~~~----~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~  140 (458)
T Consensus       282 rv~ilh~t~s~~r~~~~~~~~~~~~~L~r~~~~~~~ilitty~~~r~~~-d~l~~~~W~y~ILDEGH~IrNpn----s~i  356 (923)
T KOG0387         282 RVFILHGTGSGARYDASHSSHKKDKLLIRKVATDGGILITTYDGFRIQG-DDLLGILWDYVILDEGHRIRNPN----SKI  356 (923)
T ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHEEEECCCCCEEEEEHHHHCCCC-CCCCCCCCCEEEECCCCCCCCCC----CHH
T ss_conf             7999714776544443101344312220353046847997422420047-52346503479823765046985----089


Q ss_pred             HHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHH--HHHHHHHHH
Q ss_conf             777665430598079965840231001013467751788877532778877736956403300002455--554558999
Q gi|255764515|r  141 ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYT--AKETAQKEI  218 (458)
Q Consensus       141 ~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~--~~~~~~~~l  218 (458)
T Consensus       357 slackki--~T~~RiILSGTPiQNnL~ELwsLfDFv~PG~-Lgt-~~~F~~~f~~pI~~GgyaNAs~~qv~~aykca~~L  432 (923)
T KOG0387         357 SLACKKI--RTVHRIILSGTPIQNNLTELWSLFDFVFPGK-LGT-LPVFQQNFEHPINRGGYANASPRQVQTAYKCAVAL  432 (923)
T ss_pred             HHHHHHC--CCCCEEEEECCCCCCHHHHHHHHHHHCCCCC-CCC-HHHHHHHHHHHEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             9999861--5666488618621010899987766406774-455-17787630111003565789879999999999999


Q ss_pred             HHHHHHHHHHHHCCCCC--CCCCCCEEEEEEECCHHHHHHHHHHHHHH-HHHCCCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             99742454332000010--01001100034524536899888999999-8510334520223478888754203541000
Q gi|255764515|r  219 EAQLSDCCLSLDIADYQ--NIDKPILITKKVPLPQPVMKQYHKFQREL-YCDLQGENIEAFNSASKTVKCLQLANGAVYY  295 (458)
Q Consensus       219 ~~~l~~~~~~~~~~~~~--~l~~~~~~~~~v~l~~~~~~~y~~~~~~~-~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~  295 (458)
T Consensus       433 r~lI~PylLRR~K~dv~~~~Lp~K~E~VlfC~LT~~QR~~Y~~fl~s~~v~~i~ng~---~~~l~Gi~iLrkICnHPdll  509 (923)
T KOG0387         433 RDLISPYLLRRMKSDVKGLKLPKKEEIVLFCRLTKLQRRLYQRFLNSSEVNKILNGK---RNCLSGIDILRKICNHPDLL  509 (923)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCC---CCCEECHHHHHHHCCCCCCC
T ss_conf             987679999999988644217886525899856699999999986059899997498---44121518888645894102


Q ss_pred             CCCC---------CCHHCCCCCCCCHHHHHH--CCCCCEEEEHHHHHHHHHHHHHCCC----------CCC-CHHHHHHH
Q ss_conf             2234---------300013433332566541--2488403422236788866410002----------653-34458998
Q gi|255764515|r  296 DEEK---------HWKEVHDEKIKALEVIIE--KANAAPIIVAYHFNSDLARLQKAFP----------QGR-TLDKDPCT  353 (458)
Q Consensus       296 ~~~~---------~~~~~~~~k~~~l~~il~--~~~~~kviif~~~~~~~~~i~~~~~----------~g~-~~~~r~~~  353 (458)
T Consensus       510 ~~~~~~~~~~~D~~g~~k~sGKm~vl~~ll~~W~kqg~rvllFsqs~~mLdilE~fL~~~~~ysylRmDGtT~~~~R~~l  589 (923)
T KOG0387         510 DRRDEDEKQGPDYEGDPKRSGKMKVLAKLLKDWKKQGDRVLLFSQSRQMLDILESFLRRAKGYSYLRMDGTTPAALRQKL  589 (923)
T ss_pred             CCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHH
T ss_conf             67642123588767895652169999999999861797799841377999999999873478538971588862010578


Q ss_pred             HHHHCCC-CCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHH
Q ss_conf             7642458-855899844221116220017859999089989868644566662022020378775289999858996899
Q gi|255764515|r  354 IQEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDEL  432 (458)
Q Consensus       354 i~~f~~~-~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~  432 (458)
T Consensus       590 Vd~Fne~~s~~VFLLTTrvGGLGlNLTgA-nRVIIfDPdWNPStD~QAreRaw-----RiGQkkdV~VYRL~t~gTIEEk  663 (923)
T KOG0387         590 VDRFNEDESIFVFLLTTRVGGLGLNLTGA-NRVIIFDPDWNPSTDNQARERAW-----RIGQKKDVVVYRLMTAGTIEEK  663 (923)
T ss_pred             HHHHCCCCCEEEEEEEECCCCCCCCCCCC-CEEEEECCCCCCCCCHHHHHHHH-----HHCCCCCEEEEEEECCCCHHHH
T ss_conf             98636787457999973035541124567-55899799999764257888888-----6357465599997327718999


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999855
Q gi|255764515|r  433 VLQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       433 i~~~~~~K~~~~~~~~~~  450 (458)
T Consensus       664 iY~rQI~Kq~Ltn~il~~  681 (923)
T KOG0387         664 IYHRQIFKQFLTNRILKN  681 (923)
T ss_pred             HHHHHHHHHHHHHHHHCC
T ss_conf             999999998888887429