HHsearch alignment for GI: 255764515 and conserved domain: KOG0389

>KOG0389 consensus.
Probab=100.00  E-value=0  Score=505.98  Aligned_cols=436  Identities=19%  Similarity=0.270  Sum_probs=333.1

Q ss_pred             CCCCHHHHHHHHHHH---HCC-CEEEEECCCCCHHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             987478999999999---679-8099958899868999999999997599-94999916046569999999985588881
Q gi|255764515|r    1 MNLAPHQTKIVDWIL---DHK-RCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~---~~~-~~ll~~~~G~GKT~~al~~~~~l~~~~~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
T Consensus       398 i~LkdYQlvGvNWL~Llyk~~l~gILADEMGLGKTiQvIaFlayLkq~g~~gpHLVVvPsSTleN-WlrEf~kwC--Psl  474 (941)
T KOG0389         398 IQLKDYQLVGVNWLLLLYKKKLNGILADEMGLGKTIQVIAFLAYLKQIGNPGPHLVVVPSSTLEN-WLREFAKWC--PSL  474 (941)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCEEHHHCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCHHHHH-HHHHHHHHC--CCE
T ss_conf             73342220228999999974233053222057633489999999997299998379920316888-999999759--752


Q ss_pred             EEEEEECCHHHHHHHH------CCCCCEEEECCCCHH--HHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             5999858978988873------077986998064202--33442000113220440453100246543115677776654
Q gi|255764515|r   76 NISVITGTVKQRTKVL------KTPAVLYVINFENLG--WLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKP  147 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~------~~~~~i~i~s~e~~~--~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~  147 (458)
T Consensus       475 ~Ve~YyGSq~ER~~lR~~i~~~~~~ydVllTTY~la~~~kdDRsflk~~~~n~viyDEgHmLKN----~~SeRy~~LM~I  550 (941)
T KOG0389         475 KVEPYYGSQDERRELRERIKKNKDDYDVLLTTYNLAASSKDDRSFLKNQKFNYVIYDEGHMLKN----RTSERYKHLMSI  550 (941)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHHHHHHCCCCEEEECCHHHHHC----CCHHHHHHHCCC
T ss_conf             8774157689999999998616888528998721103886778999866666799613265421----334988875064


Q ss_pred             HHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             30598079965840231001013467751788877532778877736956403300002455554558999997424543
Q gi|255764515|r  148 AWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCL  227 (458)
Q Consensus       148 ~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~  227 (458)
T Consensus       551 --~An~RlLLTGTPLQNNL~ELiSLL~FvlP~-vF~~~~~dl~~if~~k~~~d~d~e~~~l-~q-erIsrAK~im~PFIL  625 (941)
T KOG0389         551 --NANFRLLLTGTPLQNNLKELISLLAFVLPK-VFDSSMEDLDVIFKAKKTSDGDIENALL-SQ-ERISRAKTIMKPFIL  625 (941)
T ss_pred             --CCCCEEEEECCCCCCCHHHHHHHHHHHHHH-HHHCCCHHHHHHHHCCCCCCCHHHHHHH-HH-HHHHHHHHHHHHHHH
T ss_conf             --655358851874201299999999997457-5532224799998246776430467788-99-999999975427889


Q ss_pred             HHHCCCC-CCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCH-HHHHHHHHHHHHHCCCCCCCCCCC-------
Q ss_conf             3200001-0010011000345245368998889999998510334520-223478888754203541000223-------
Q gi|255764515|r  228 SLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIE-AFNSASKTVKCLQLANGAVYYDEE-------  298 (458)
Q Consensus       228 ~~~~~~~-~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~q~~~~~~~~~~~-------  298 (458)
T Consensus       626 RR~K~qVL~~LPpK~~~Ie~c~mse~Q~~~Y~~~~~~~~~~~~~~~~ns~~~~~~vlmqlRK~AnHPLL~R~~Y~de~L~  705 (941)
T KOG0389         626 RRLKSQVLKQLPPKIQRIEYCEMSEKQKQLYDELIELYDVKLNEVSKNSELKSGNVLMQLRKAANHPLLFRSIYTDEKLR  705 (941)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHCCHHHHH
T ss_conf             99899898746974325676424638999999999998511043223310256139999998735725778760388999


Q ss_pred             ----------------C-------------------------------CCHHCCCCCCCCHHHHHHC--CCCCEEEEHHH
Q ss_conf             ----------------4-------------------------------3000134333325665412--48840342223
Q gi|255764515|r  299 ----------------K-------------------------------HWKEVHDEKIKALEVIIEK--ANAAPIIVAYH  329 (458)
Q Consensus       299 ----------------~-------------------------------~~~~~~~~k~~~l~~il~~--~~~~kviif~~  329 (458)
T Consensus       706 ~mak~il~e~ay~~~n~qyIfEDm~~msDfelHqLc~~f~~~~~f~L~d~~~mdSgK~r~L~~LLp~~k~~G~RVLiFSQ  785 (941)
T KOG0389         706 KMAKRILNEPAYKKANEQYIFEDMEVMSDFELHQLCCQFRHLSKFQLKDDLWMDSGKCRKLKELLPKIKKKGDRVLIFSQ  785 (941)
T ss_pred             HHHHHHHCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEH
T ss_conf             99999727553320278888998876518999999986578765323884443003276999987887616877999608


Q ss_pred             HHHHHHHHHHCC---------CCCCC-HHHHHHHHHHHCCC-CCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHH
Q ss_conf             678886641000---------26533-44589987642458-85589984422111622001785999908998986864
Q gi|255764515|r  330 FNSDLARLQKAF---------PQGRT-LDKDPCTIQEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQ  398 (458)
Q Consensus       330 ~~~~~~~i~~~~---------~~g~~-~~~r~~~i~~f~~~-~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~  398 (458)
T Consensus       786 FTqmLDILE~~L~~l~~~ylRLDGsTqV~~RQ~lId~Fn~d~difVFLLSTKAGG~GINLt~A-n~VIihD~dFNP~dD~  864 (941)
T KOG0389         786 FTQMLDILEVVLDTLGYKYLRLDGSTQVNDRQDLIDEFNTDKDIFVFLLSTKAGGFGINLTCA-NTVIIHDIDFNPYDDK  864 (941)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEEECCCCCEECCCCC-CEEEEEECCCCCCCCC
T ss_conf             889999999999862733786148864138999998626677557999861467650211236-4589960577975520


Q ss_pred             HHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             45666620220203787752899998589968999999999999999998554137
Q gi|255764515|r  399 QMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE  454 (458)
Q Consensus       399 Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~~~~~  454 (458)
T Consensus       865 QAEDRc-----HRvGQtkpVtV~rLItk~TIEE~I~~lA~~KL~Le~~lt~~~k~~  915 (941)
T KOG0389         865 QAEDRC-----HRVGQTKPVTVYRLITKSTIEEGILRLAKTKLALEADLTEDGKGV  915 (941)
T ss_pred             HHHHHH-----HHHCCCCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCH
T ss_conf             468888-----761785406999987457189999999987654555532576431