HHsearch alignment for GI: 255764515 and conserved domain: KOG0737

>KOG0737 consensus.
Probab=95.84  E-value=0.046  Score=30.77  Aligned_cols=47  Identities=23%  Similarity=0.283  Sum_probs=27.0

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             9809995889986899999999999759994999916046569999999985
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRW   69 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf   69 (458)
T Consensus       128 kGiLL~GPpG~GKTmlAKA~Ake---aga~fInv~~--s~lt~KWfgE~eKl  174 (386)
T KOG0737         128 KGILLYGPPGTGKTMLAKAIAKE---AGANFINVSV--SNLTSKWFGEAQKL  174 (386)
T ss_pred             CCCEECCCCCCHHHHHHHHHHHH---CCCCCCEEEC--CCCCHHHHHHHHHH
T ss_conf             43051189982188999999987---2797100013--65532667778889