HHsearch alignment for GI: 255764515 and conserved domain: KOG0920

>KOG0920 consensus.
Probab=97.65  E-value=0.001  Score=40.80  Aligned_cols=148  Identities=18%  Similarity=0.093  Sum_probs=67.4

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH-HHHHCCCCCEEEEE--CCH--HHH-HHHHHHHHHHCCCCC--C
Q ss_conf             478999999999679809995889986899999999-99975999499991--604--656-999999998558888--1
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIA--PLR--VAQ-SVWTSEVQRWSNFSH--M   75 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~-~l~~~~~~~~LIv~--P~~--l~~-~~W~~Ei~kf~~~~~--~   75 (458)
T Consensus       175 ~~~r~~Il~~i~~~qVvvIsGeTGcGKtTQvpQfiLd~~~~~~-~~~~IicTQPRRIsAIsvAeRVa-~ER~-~~~g~~V  251 (924)
T KOG0920         175 YKMRDTILDAIEENQVVVISGETGCGKTTQVPQFILDEAIESG-AACNIICTQPRRISAISVAERVA-KERG-ESLGEEV  251 (924)
T ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHHHHHHHHHCC-CCCEEEECCCCHHHHHHHHHHHH-HHHC-CCCCCEE
T ss_conf             7789999999974966999578898712246699999998628-99738866775177899999998-8754-6668713


Q ss_pred             EEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             59998589789888730779869980642023344200011322044045310024654311567777665430598079
Q gi|255764515|r   76 NISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFI  155 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l  155 (458)
T Consensus       252 GYqvrl~~~~s~------~t~L~fcTtGvLLr~L~~~~~l~~~thiivDEVHER-~i~~DflLi~lk~lL~~~-p~LkvI  323 (924)
T KOG0920         252 GYQVRLESKRSR------ETRLLFCTTGVLLRRLQSDPTLSGVTHIIVDEVHER-SINTDFLLILLKDLLPRN-PDLKVI  323 (924)
T ss_pred             EEEEEEECCCCC------CEEEEEECHHHHHHHHCCCCCCCCCCEEEEEEEEEC-CCCCCCHHHHHHHHHHHC-CCCEEE
T ss_conf             689862013677------516898406899987546862145866544227971-677521799999886228-885699


Q ss_pred             EECCCCH
Q ss_conf             9658402
Q gi|255764515|r  156 ELTGTPS  162 (458)
Q Consensus       156 ~LTgTPi  162 (458)
T Consensus       324 LMSAT~d  330 (924)
T KOG0920         324 LMSATLD  330 (924)
T ss_pred             EEEEECC
T ss_conf             8621126