HHsearch alignment for GI: 255764515 and conserved domain: KOG0953

>KOG0953 consensus.
Probab=98.65  E-value=1.1e-06  Score=58.72  Aligned_cols=84  Identities=17%  Similarity=0.240  Sum_probs=56.4

Q ss_pred             CCCEEEEHHHHH-----HHHHH----HHHCCCCCCCHHHHHHHHHHHCC--CCCCEEEEEHHHCCCCCCCCCCCCEEEEE
Q ss_conf             884034222367-----88866----41000265334458998764245--88558998442211162200178599990
Q gi|255764515|r  320 NAAPIIVAYHFN-----SDLAR----LQKAFPQGRTLDKDPCTIQEWNE--GKIPLLFAHPASCGHGLNLQYGGNILVFF  388 (458)
Q Consensus       320 ~~~kviif~~~~-----~~~~~----i~~~~~~g~~~~~r~~~i~~f~~--~~~~vli~s~~~~~~GlnL~~a~~~iI~~  388 (458)
T Consensus       357 ~GDCvV~FSkk~I~~~k~kIE~~g~~k~aVIYGsLPPeTr~aQA~~FNd~~~e~dvlVAs-DAIGMGLNL~--IrRiiF~  433 (700)
T KOG0953         357 PGDCVVAFSKKDIFTVKKKIEKAGNHKCAVIYGSLPPETRLAQAALFNDPSNECDVLVAS-DAIGMGLNLN--IRRIIFY  433 (700)
T ss_pred             CCCEEEEEEHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEE-CCCCCCCCCC--EEEEEEE
T ss_conf             887699941114888899999855855489955899730688898737988762568862-3214554443--1179875


Q ss_pred             CCC---------CCHHHHHHHHHHHHC
Q ss_conf             899---------898686445666620
Q gi|255764515|r  389 SLW---------WDLEEHQQMIERIGV  406 (458)
Q Consensus       389 ~~~---------wn~~~~~Q~~gRi~~  406 (458)
T Consensus       434 sl~Kysg~e~~~it~sqikQIAGRAGR  460 (700)
T KOG0953         434 SLIKYSGRETEDITVSQIKQIAGRAGR  460 (700)
T ss_pred             ECCCCCCCCCEECCHHHHHHHHHCCCC
T ss_conf             035677662102568999988510154