HHsearch alignment for GI: 255764515 and conserved domain: KOG1000

>KOG1000 consensus.
Probab=100.00  E-value=0  Score=412.04  Aligned_cols=406  Identities=22%  Similarity=0.260  Sum_probs=296.1

Q ss_pred             CCCHHHHHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             8747899999999967-980999588998689999999999975999499991604656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDH-KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~-~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
T Consensus       198 ~LlPFQreGv~faL~RgGR~llADeMGLGKTiQAlaIA~yy--raEwplliVcPAsvrf-tWa~al~r~lps~~p-i~vv  273 (689)
T KOG1000         198 RLLPFQREGVIFALERGGRILLADEMGLGKTIQALAIARYY--RAEWPLLIVCPASVRF-TWAKALNRFLPSIHP-IFVV  273 (689)
T ss_pred             HHCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH--HHCCCEEEEECHHHHH-HHHHHHHHHCCCCCC-EEEE
T ss_conf             61703565478898538739984124541688999999998--6048679992278868-999999985310260-4788


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             58978988873077986998064202334420001132204404531002465431156777766543059807996584
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
T Consensus       274 ~~~~D~-~~~~~t~~~v~ivSye~ls~l~~~l~~-~~~~vvI~DEsH~Lk~skt----kr~Ka~~dllk~akhvILLSGT  347 (689)
T KOG1000         274 DKSSDP-LPDVCTSNTVAIVSYEQLSLLHDILKK-EKYRVVIFDESHMLKDSKT----KRTKAATDLLKVAKHVILLSGT  347 (689)
T ss_pred             ECCCCC-CCCCCCCCEEEEEEHHHHHHHHHHHHC-CCCEEEEEECHHHHHCCCH----HHHHHHHHHHHHHHHEEEECCC
T ss_conf             526677-654566772789878999999998736-5411899712565410112----2366665699876444772388


Q ss_pred             CHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHCCCCC-CCC
Q ss_conf             023100101346775178887753277887773695640330000245555455899999742-454332000010-010
Q gi|255764515|r  161 PSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLS-DCCLSLDIADYQ-NID  238 (458)
Q Consensus       161 Pi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~-~~~~~~~~~~~~-~l~  238 (458)
T Consensus       348 PavSRP~elytqi~avd~--tlfp~f~efa~rYCd~k~vr~~~D----ykg~tnl~EL~~lL~k~lMIRRlK~dvL~qLP  421 (689)
T KOG1000         348 PAVSRPSELYTQIRAVDH--TLFPNFHEFAIRYCDGKQVRFCFD----YKGCTNLEELAALLFKRLMIRRLKADVLKQLP  421 (689)
T ss_pred             CCCCCCHHHHHHHHHHCC--CCCCCHHHHHHHHCCCCCCCEEEE----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             556781442135554121--004228998777537641102450----37787789999999999999999998875388


Q ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHH-
Q ss_conf             0110003452453689988899999985103345202234788887542035410002234300013433332566541-
Q gi|255764515|r  239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE-  317 (458)
Q Consensus       239 ~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~-  317 (458)
T Consensus       422 pK-rr~Vv~~~~gr~da~~~~lv~~a~~-~t~~~~~e~~~~~l~l~----------------y~~tgiaK~~av~eyi~~  483 (689)
T KOG1000         422 PK-RREVVYVSGGRIDARMDDLVKAAAD-YTKVNSMERKHESLLLF----------------YSLTGIAKAAAVCEYILE  483 (689)
T ss_pred             CC-CEEEEEECCCCCCHHHHHHHHHHHH-CCHHHHHHHHHHHHHHH----------------HHHHCCCCCHHHHHHHHH
T ss_conf             01-0489997478622678999987532-00123666656778878----------------987511020889999974


Q ss_pred             -----CCCCCEEEEHHHHHHHHHHHHHCC---------CCCCCH-HHHHHHHHHHC-CCCCCEEEEEHHHCCCCCCCCCC
Q ss_conf             -----248840342223678886641000---------265334-45899876424-58855899844221116220017
Q gi|255764515|r  318 -----KANAAPIIVAYHFNSDLARLQKAF---------PQGRTL-DKDPCTIQEWN-EGKIPLLFAHPASCGHGLNLQYG  381 (458)
Q Consensus       318 -----~~~~~kviif~~~~~~~~~i~~~~---------~~g~~~-~~r~~~i~~f~-~~~~~vli~s~~~~~~GlnL~~a  381 (458)
T Consensus       484 ~~~l~d~~~~KflVFaHH~~vLd~Iq~~~~~r~vg~IRIDGst~s~~R~ll~qsFQ~seev~VAvlsItA~gvGLt~t-A  562 (689)
T KOG1000         484 NYFLPDAPPRKFLVFAHHQIVLDTIQVEVNKRKVGSIRIDGSTPSHRRTLLCQSFQTSEEVRVAVLSITAAGVGLTLT-A  562 (689)
T ss_pred             CCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEEEEECCCCEEEE-C
T ss_conf             744456887359999414879999999998747975885698984347899987314631479999986314441465-1


Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             859999089989868644566662022020378775289999858996899999999999999999
Q gi|255764515|r  382 GNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLL  447 (458)
Q Consensus       382 ~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~  447 (458)
T Consensus       563 a~~VVFaEL~wnPgvLlQAEDRa-----HRiGQkssV~v~ylvAKgT~Ddy~Wp~l~~KL~vl~s~  623 (689)
T KOG1000         563 ASVVVFAELHWNPGVLLQAEDRA-----HRIGQKSSVFVQYLVAKGTADDYMWPMLQQKLDVLGSV  623 (689)
T ss_pred             CCEEEEEEECCCCCEEEECHHHH-----HHCCCCCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             32589998237875477514656-----64056651138999954845777789999998788662