HHsearch alignment for GI: 255764515 and conserved domain: KOG1015

>KOG1015 consensus.
Probab=100.00  E-value=0  Score=426.42  Aligned_cols=433  Identities=22%  Similarity=0.297  Sum_probs=312.8

Q ss_pred             CCCCHHHHHHHHHHHHC-------------CCEEEEECCCCCHHHHHHHHHHHHHH---CCCCCEEEEECCHHHHHHHHH
Q ss_conf             98747899999999967-------------98099958899868999999999997---599949999160465699999
Q gi|255764515|r    1 MNLAPHQTKIVDWILDH-------------KRCAIWASMGSGKTVSVLTALSYIHL---WGEKSVLVIAPLRVAQSVWTS   64 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~-------------~~~ll~~~~G~GKT~~al~~~~~l~~---~~~~~~LIv~P~~l~~~~W~~   64 (458)
T Consensus       667 ~kLKpHQv~GvqFMwd~~~eSlkr~~~~~GsGcILAHcMGLGKTlQVvtflhTvL~c~klg~ktaLvV~PlNt~~-NW~~  745 (1567)
T KOG1015         667 IKLKPHQVDGVQFMWDCCCESLKRTKKSPGSGCILAHCMGLGKTLQVVTFLHTVLLCDKLGFKTALVVCPLNTAL-NWMN  745 (1567)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCEEHHHHHHHHHHHHHCCCCCEEEEECCHHHHH-HHHH
T ss_conf             644722013025899999999886127998631778750456400146788899874204785689972359988-9999


Q ss_pred             HHHHHCCC----CCCEEEEEEC--CHHHH---HHHHCCCCCEEEECCCCHHHHHHHC--------------CCCCCCCEE
Q ss_conf             99985588----8815999858--97898---8873077986998064202334420--------------001132204
Q gi|255764515|r   65 EVQRWSNF----SHMNISVITG--TVKQR---TKVLKTPAVLYVINFENLGWLVQEL--------------KGTWPFATI  121 (458)
Q Consensus        65 Ei~kf~~~----~~~~~~~~~g--~~~~r---~~~~~~~~~i~i~s~e~~~~~~~~~--------------~~~~~~~~i  121 (458)
T Consensus       746 EFekWm~~~e~~~~leV~eL~~vkr~e~R~~~L~~W~~~ggVmIiGYdmyRnLa~gr~vk~rk~ke~f~k~lvdpGPD~v  825 (1567)
T KOG1015         746 EFEKWMEGLEDDEKLEVSELATVKRPEERSYMLQRWQEDGGVMIIGYDMYRNLAQGRNVKSRKLKEIFNKALVDPGPDFV  825 (1567)
T ss_pred             HHHHHCCCCCCCCCCEEEHHHHCCCHHHHHHHHHHHHHCCCEEEEEHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             99986124222466212021202674889999999975297799736888877514560356799999986057899768


Q ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCC
Q ss_conf             40453100246543115677776654305980799658402310010134677517888775327788777369564033
Q gi|255764515|r  122 VVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGS  201 (458)
Q Consensus       122 IiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~  201 (458)
T Consensus       826 VCDE~HiLKNeks----a~Skam~~i--rtkRRI~LTGTPLQNNLmEY~CMVnFVKe~-lLGs-~~EfrNRFvNpI~nGq  897 (1567)
T KOG1015         826 VCDEGHILKNEKS----AVSKAMNSI--RTKRRIILTGTPLQNNLMEYHCMVNFVKEN-LLGS-IKEFRNRFVNPIQNGQ  897 (1567)
T ss_pred             EECCHHHHCCCHH----HHHHHHHHH--HHHEEEEEECCCHHHHHHHHHHHHHHCCCC-CCCC-CHHHHHHHCCCCCCCC
T ss_conf             7242122135247----899999987--764047752671133248887888760433-3457-5889976238222675


Q ss_pred             CHHHHHH--HHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHH---
Q ss_conf             0000245--55545589999974245433200001-00100110003452453689988899999985103345202---
Q gi|255764515|r  202 HIGAVRY--TAKETAQKEIEAQLSDCCLSLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEA---  275 (458)
Q Consensus       202 ~~~~~~~--~~~~~~~~~l~~~l~~~~~~~~~~~~-~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~---  275 (458)
T Consensus       898 ~~dST~~DVr~Mk~RsHILye~LkgcVqRkDy~Vltk~LPPK~eyVi~vrltelQ~~LYq~yL~h~--~~~G~d~eg~~g  975 (1567)
T KOG1015         898 CADSTMVDVRVMKKRSHILYEMLKGCVQRKDYTVLTKFLPPKHEYVIAVRLTELQCKLYQYYLDHL--TGVGNDSEGGRG  975 (1567)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCHHHHHHHHHHHHHC--CCCCCCCCCCCC
T ss_conf             577738889999888899999998787531055531458986269999862599999999998631--256875335442


Q ss_pred             --HHHHHHHHHHHHCCCCCCCC----------------------------------------------------------
Q ss_conf             --23478888754203541000----------------------------------------------------------
Q gi|255764515|r  276 --FNSASKTVKCLQLANGAVYY----------------------------------------------------------  295 (458)
Q Consensus       276 --~~~~~~~~~l~q~~~~~~~~----------------------------------------------------------  295 (458)
T Consensus       976 ~~arlf~dfqmlsrIwtHP~~lqL~s~~~enkR~~seddm~~fi~D~sde~e~s~~s~d~~~~~ks~~~s~~Desss~~~ 1055 (1567)
T KOG1015         976 AGARLFQDFQMLSRIWTHPWCLQLDSISKENKRYFSEDDMDEFIADDSDETEMSLSSDDYTKKKKSGKKSKKDESSSGSG 1055 (1567)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEECHHHHHHCCCCCCCCHHCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCC
T ss_conf             23567788999999964887423135665411335643200255678741001236663011023344566655555556


Q ss_pred             -----------------------------------------------------------CCCCCCHHCCCCCCCCHHHHH
Q ss_conf             -----------------------------------------------------------223430001343333256654
Q gi|255764515|r  296 -----------------------------------------------------------DEEKHWKEVHDEKIKALEVII  316 (458)
Q Consensus       296 -----------------------------------------------------------~~~~~~~~~~~~k~~~l~~il  316 (458)
T Consensus      1056 ~~g~~ev~k~k~rk~r~~~~~~~~~~g~~~D~~l~ll~dlag~~s~~~d~ppew~kd~v~e~d~~v~~~SgKmiLLleIL 1135 (1567)
T KOG1015        1056 SDGDVEVIKVKNRKSRGGGEGNVDETGNNPDVSLKLLEDLAGSSSNPSDPPPEWYKDFVTEADAEVLEHSGKMILLLEIL 1135 (1567)
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEHHHHHH
T ss_conf             67752443210021036656764223788625789863214554477888557677665441123440376224599999


Q ss_pred             H--CCCCCEEEEHHHHHHHHHHHHHCC-------------------------------CCC-CCHHHHHHHHHHHCCCC-
Q ss_conf             1--248840342223678886641000-------------------------------265-33445899876424588-
Q gi|255764515|r  317 E--KANAAPIIVAYHFNSDLARLQKAF-------------------------------PQG-RTLDKDPCTIQEWNEGK-  361 (458)
Q Consensus       317 ~--~~~~~kviif~~~~~~~~~i~~~~-------------------------------~~g-~~~~~r~~~i~~f~~~~-  361 (458)
T Consensus      1136 ~mceeIGDKlLVFSQSL~SLdLIe~fLe~v~r~gk~~~d~~~~~~~eGkW~~GkDyyriDGst~s~~R~k~~~~FNdp~N 1215 (1567)
T KOG1015        1136 RMCEEIGDKLLVFSQSLISLDLIEDFLELVSREGKEDKDKPLIYKGEGKWLRGKDYYRLDGSTTSQSRKKWAEEFNDPTN 1215 (1567)
T ss_pred             HHHHHHCCEEEEEECCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEECCCCEEEECCCCCHHHHHHHHHHHCCCCC
T ss_conf             99997365368762333225899999986024686544464222555522047743775485537889999998468335


Q ss_pred             --CCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHH
Q ss_conf             --558998442211162200178599990899898686445666620220203787752899998589968999999999
Q gi|255764515|r  362 --IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRT  439 (458)
Q Consensus       362 --~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~  439 (458)
T Consensus      1216 lRaRl~LISTRAGsLGiNLv-AANRVIIfDasWNPSyDtQSIFRv-----yRfGQtKPvyiYRfiAqGTmEeKIYkRQVT 1289 (1567)
T KOG1015        1216 LRARLFLISTRAGSLGINLV-AANRVIIFDASWNPSYDTQSIFRV-----YRFGQTKPVYIYRFIAQGTMEEKIYKRQVT 1289 (1567)
T ss_pred             CEEEEEEEEECCCCCCCCEE-ECCEEEEEECCCCCCCCHHHHHHH-----HHHCCCCCEEEHHHHHCCCHHHHHHHHHHH
T ss_conf             01379999622676520023-314289994555875206889999-----860576731401445414088899998876


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999855
Q gi|255764515|r  440 KSTIQDLLLNA  450 (458)
Q Consensus       440 K~~~~~~~~~~  450 (458)
T Consensus      1290 Kqsls~RVVDe 1300 (1567)
T KOG1015        1290 KQSLSFRVVDE 1300 (1567)
T ss_pred             HHHHHHHHHHH
T ss_conf             75543543029