HHsearch alignment for GI: 255764515 and conserved domain: KOG1016

>KOG1016 consensus.
Probab=100.00  E-value=0  Score=351.09  Aligned_cols=434  Identities=21%  Similarity=0.303  Sum_probs=306.1

Q ss_pred             CCHHHHHHHHHHHHC-------------CCEEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             747899999999967-------------98099958899868999999999997-5999499991604656999999998
Q gi|255764515|r    3 LAPHQTKIVDWILDH-------------KRCAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVAQSVWTSEVQR   68 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~-------------~~~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~~~~W~~Ei~k   68 (458)
T Consensus       255 ~kPHQiGGiRFlYDN~iESl~rykkSsGFGCILAHSMGLGKTlQVisF~diflRhT~AKtVL~ivPiNTlQN-WlsEfnm  333 (1387)
T KOG1016         255 LKPHQIGGIRFLYDNTIESLGRYKKSSGFGCILAHSMGLGKTLQVISFSDIFLRHTKAKTVLVIVPINTLQN-WLSEFNM  333 (1387)
T ss_pred             CCCCCCCCEEEEHHHHHHHHHHCCCCCCCCEEEEECCCCCCEEEEEEHHHHHHHCCCCCEEEEEEEHHHHHH-HHHHHHH
T ss_conf             581001757875031788876301467763200000256742588666677864276644899986078888-9998532


Q ss_pred             HCCCC---------CCEEEEEECCHH---HHH---HHHCCCCCEEEECCCCHHHHHHHC---------------------
Q ss_conf             55888---------815999858978---988---873077986998064202334420---------------------
Q gi|255764515|r   69 WSNFS---------HMNISVITGTVK---QRT---KVLKTPAVLYVINFENLGWLVQEL---------------------  112 (458)
Q Consensus        69 f~~~~---------~~~~~~~~g~~~---~r~---~~~~~~~~i~i~s~e~~~~~~~~~---------------------  112 (458)
T Consensus       334 WiP~y~sD~~vrpR~F~vf~LnD~~KT~~~Rakvi~~Wv~~GGVlLvGYemfRLL~lk~~~~~grpkkt~kr~~~~~i~~  413 (1387)
T KOG1016         334 WIPKYFSDTGVRPRSFEVFLLNDGVKTFDQRAKVIEQWVQTGGVLLVGYEMFRLLILKTLPKKGRPKKTLKRISSGFIKD  413 (1387)
T ss_pred             HCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             06777666787653047898247304589999999987603978986189999998730233587420001467740377


Q ss_pred             ----------------CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHC
Q ss_conf             ----------------0011322044045310024654311567777665430598079965840231001013467751
Q gi|255764515|r  113 ----------------KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL  176 (458)
Q Consensus       113 ----------------~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l  176 (458)
T Consensus       414 d~eD~~qe~~~li~~AL~~PGPDlVICDEGHrIKN~~A~-iS~aLk~I-----rtrRRiVLTGYPLQNNLlEYwCMVDFV  487 (1387)
T KOG1016         414 DSEDQRQEAYSLIRSALLEPGPDLVICDEGHRIKNITAE-ISMALKAI-----RTRRRIVLTGYPLQNNLLEYWCMVDFV  487 (1387)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCEEEECCCCEECCCHHH-HHHHHHHH-----HHCEEEEEECCCCCCCHHHHHHHHEEC
T ss_conf             401468999999999843789976882588521332278-89999875-----431068874665531168775642001


Q ss_pred             CCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHH--HHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCEEEEEEECCHHH
Q ss_conf             78887753277887773695640330000245555--45589999974245433200001-0010011000345245368
Q gi|255764515|r  177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAK--ETAQKEIEAQLSDCCLSLDIADY-QNIDKPILITKKVPLPQPV  253 (458)
Q Consensus       177 ~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~--~~~~~~l~~~l~~~~~~~~~~~~-~~l~~~~~~~~~v~l~~~~  253 (458)
T Consensus       488 RP~-yLGTR-~eF~nmFErPI~NGQCvDStPdDvklmryRtHVLhsLl~GFVQRR~HtvLk~~LP~k~EyViLvr~s~iQ  565 (1387)
T KOG1016         488 RPK-YLGTR-KEFINMFERPIKNGQCVDSTPDDVKLMRYRTHVLHSLLKGFVQRRTHTVLKKILPEKKEYVILVRKSQIQ  565 (1387)
T ss_pred             CCC-CCCHH-HHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHCCCCCCEEEEEEHHHHH
T ss_conf             533-23308-9998886456547845568806889999999999999999988502255766455531148888688899


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCC---------------------------------------
Q ss_conf             99888999999851033452022347888875420354100---------------------------------------
Q gi|255764515|r  254 MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY---------------------------------------  294 (458)
Q Consensus       254 ~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~---------------------------------------  294 (458)
T Consensus       566 R~LY~~Fm~d~~r~~~~~~~~~~NPLkAF~vCcKIWNHPDVLY~~l~k~~~a~e~dl~vee~~~ag~~~~~~P~~~~~~~  645 (1387)
T KOG1016         566 RQLYRNFMLDAKREIAANNDAVFNPLKAFSVCCKIWNHPDVLYRLLEKKKRAEEDDLRVEEMKFAGLQQQQSPFNSIPSN  645 (1387)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             99999999999876401466344728999999875078189999998764200321127887542001237988788899


Q ss_pred             ---------------------------CCCCCC------------------CHHCCCCCCCCHHHHHHCC--CCCEEEEH
Q ss_conf             ---------------------------022343------------------0001343333256654124--88403422
Q gi|255764515|r  295 ---------------------------YDEEKH------------------WKEVHDEKIKALEVIIEKA--NAAPIIVA  327 (458)
Q Consensus       295 ---------------------------~~~~~~------------------~~~~~~~k~~~l~~il~~~--~~~kviif  327 (458)
T Consensus       646 ~s~~laSs~~k~~n~t~kp~~s~~~p~f~ee~~e~~~y~~w~~el~~nYq~gvLen~pk~V~~~~~~des~~~g~kil~f  725 (1387)
T KOG1016         646 PSTPLASSTSKSANKTKKPRGSKKAPKFDEEDEEVEKYSDWTFELFENYQEGVLENGPKIVISLEILDESTQIGEKILIF  725 (1387)
T ss_pred             CCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCCCCEEEEE
T ss_conf             88755550445533567866676799722246651112157888876410111268986699876602201347458884


Q ss_pred             HHHHHHHHHHHHCCC---------------------------CCCC-HHHHHHHHHHHCCCC-C-CEEEEEHHHCCCCCC
Q ss_conf             236788866410002---------------------------6533-445899876424588-5-589984422111622
Q gi|255764515|r  328 YHFNSDLARLQKAFP---------------------------QGRT-LDKDPCTIQEWNEGK-I-PLLFAHPASCGHGLN  377 (458)
Q Consensus       328 ~~~~~~~~~i~~~~~---------------------------~g~~-~~~r~~~i~~f~~~~-~-~vli~s~~~~~~Gln  377 (458)
T Consensus       726 Sq~l~~Ld~ieeil~krq~pc~~gdnG~~aqkW~~n~sy~rldG~t~a~~rekLinqfN~e~~lsWlfllstrag~lGin  805 (1387)
T KOG1016         726 SQNLTALDMIEEILKKRQIPCKDGDNGCPAQKWEKNRSYLRLDGTTSAADREKLINQFNSEPGLSWLFLLSTRAGSLGIN  805 (1387)
T ss_pred             ECCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCEECCCCCCCCCHHHHHHHHCCCCCCCEEEEEEHHCCCCCCCE
T ss_conf             02014889999997433166899988884154443023330468766524999998516887852443331025643202


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00178599990899898686445666620220203787752899998589968999999999999999998554
Q gi|255764515|r  378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNAL  451 (458)
Q Consensus       378 L~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~~  451 (458)
T Consensus       806 LIsa-nr~~ifda~wnpchdaqavcRv-----yrYGQ~KpcfvYRlVmD~~lEkkIydRQIsKqGmsdRvVDd~  873 (1387)
T KOG1016         806 LISA-NRCIIFDACWNPCHDAQAVCRV-----YRYGQQKPCFVYRLVMDNSLEKKIYDRQISKQGMSDRVVDDA  873 (1387)
T ss_pred             EECC-CEEEEEEEECCCCCCCHHHHHH-----HHHCCCCCEEEEEEHHHHHHHHHHHHHHHHHCCCHHHHHCCC
T ss_conf             3216-6079997305740132012556-----641574761687530222567878888876624303311013