HHsearch alignment for GI: 255764515 and conserved domain: KOG1123

>KOG1123 consensus.
Probab=99.95  E-value=1.6e-26  Score=178.85  Aligned_cols=334  Identities=19%  Similarity=0.266  Sum_probs=222.5

Q ss_pred             CCCHHHHHHHHHHHHCCC---EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             874789999999996798---09995889986899999999999759994999916046569999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKR---CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~---~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~   78 (458)
T Consensus       302 ~iRpYQEksL~KMFGNgRARSGiIVLPCGAGKtLVGvTAa~ti----kK~clvLcts~VSVeQWkqQfk~wsti~d~~i~  377 (776)
T KOG1123         302 QIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGVTAACTI----KKSCLVLCTSAVSVEQWKQQFKQWSTIQDDQIC  377 (776)
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCCEEEEEEEEEE----CCCEEEEECCCCCHHHHHHHHHHHHCCCCCCEE
T ss_conf             5575378789997378854476189856998742545555455----142799955756699999998745016855457


Q ss_pred             EEECCHHHHHHHHCCCCCEEEECCCCHHHHH---------HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9858978988873077986998064202334---------4200011322044045310024654311567777665430
Q gi|255764515|r   79 VITGTVKQRTKVLKTPAVLYVINFENLGWLV---------QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        79 ~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~---------~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
T Consensus       378 rFTsd~Ke~---~~~~~gvvvsTYsMva~t~kRS~eaek~m~~l~~~EWGllllDEVHvv-------PA~MFRRVlsiv-  446 (776)
T KOG1123         378 RFTSDAKER---FPSGAGVVVTTYSMVAYTGKRSHEAEKIMDFLRGREWGLLLLDEVHVV-------PAKMFRRVLSIV-  446 (776)
T ss_pred             EEECCCCCC---CCCCCCEEEEEEEHHHHCCCCCHHHHHHHHHHHCCEEEEEEEEHHCCC-------HHHHHHHHHHHH-
T ss_conf             720244545---789885799873131105664277999999984371016884211112-------699999999999-


Q ss_pred             CCCEEEEECCCCHHH--HCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             598079965840231--001013467751788877532778877736956403300002455554558999997424543
Q gi|255764515|r  150 ESERFIELTGTPSPN--GLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCL  227 (458)
Q Consensus       150 ~~~~~l~LTgTPi~n--~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~  227 (458)
T Consensus       447 ~aHcKLGLTATLvREDdKI~D----LNFLIGP-------KlYEAnWmdL~~kG------------------------hIA  491 (776)
T KOG1123         447 QAHCKLGLTATLVREDDKITD----LNFLIGP-------KLYEANWMDLQKKG------------------------HIA  491 (776)
T ss_pred             HHHHHCCCEEEEEECCCCCCC----CCEEECC-------HHHHCCHHHHHHCC------------------------CEE
T ss_conf             987612651478512663333----3000054-------32112489897478------------------------046


Q ss_pred             HHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCC
Q ss_conf             32000010010011000345245368998889999998510334520223478888754203541000223430001343
Q gi|255764515|r  228 SLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDE  307 (458)
Q Consensus       228 ~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~  307 (458)
T Consensus       492 ---~VqC--------aEVWCpMt~eFy~eYL~~~t~-------kr-----------~lL---------------yvMNP~  527 (776)
T KOG1123         492 ---KVQC--------AEVWCPMTPEFYREYLRENTR-------KR-----------MLL---------------YVMNPN  527 (776)
T ss_pred             ---EEEE--------EEEECCCCHHHHHHHHHHHHH-------HH-----------HEE---------------EECCCC
T ss_conf             ---7765--------314557788999999853145-------44-----------122---------------441740


Q ss_pred             CCCCHHHHHH--CCCCCEEEEHHHHHHHHHHH----H-HCCCCCCCHHHHHHHHHHHC-CCCCCEEEEEHHHCCCCCCCC
Q ss_conf             3332566541--24884034222367888664----1-00026533445899876424-588558998442211162200
Q gi|255764515|r  308 KIKALEVIIE--KANAAPIIVAYHFNSDLARL----Q-KAFPQGRTLDKDPCTIQEWN-EGKIPLLFAHPASCGHGLNLQ  379 (458)
Q Consensus       308 k~~~l~~il~--~~~~~kviif~~~~~~~~~i----~-~~~~~g~~~~~r~~~i~~f~-~~~~~vli~s~~~~~~GlnL~  379 (458)
T Consensus       528 KFraCqfLI~~HE~RgDKiIVFsDnvfALk~YAikl~KpfIYG~Tsq~ERm~ILqnFq~n~~vNTIFlS-KVgDtSiDLP  606 (776)
T KOG1123         528 KFRACQFLIKFHERRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQNERMKILQNFQTNPKVNTIFLS-KVGDTSIDLP  606 (776)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHCCCCCCCCEEEEE-ECCCCCCCCC
T ss_conf             337889999999864983899825088999999970896377888555899999853448733348875-0357655677


Q ss_pred             CCCCEEEEECCCC-CHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHH
Q ss_conf             1785999908998-9868644566662022020378775289999858996899
Q gi|255764515|r  380 YGGNILVFFSLWW-DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDEL  432 (458)
Q Consensus       380 ~a~~~iI~~~~~w-n~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~  432 (458)
T Consensus       607 EA-nvLIQISSH~GSRRQEAQRLGRILRAK-k~~de~fnafFYSLVS~DTqEM~  658 (776)
T KOG1123         607 EA-NVLIQISSHGGSRRQEAQRLGRILRAK-KRNDEEFNAFFYSLVSKDTQEMY  658 (776)
T ss_pred             CC-CEEEEECCCCCCHHHHHHHHHHHHHHH-HCCCCCCCEEEEEEEECCHHHHH
T ss_conf             66-089997245662278999988998776-33760200024443106418877