HHsearch alignment for GI: 255764515 and conserved domain: PRK03992

>PRK03992 proteasome-activating nucleotidase; Provisional.
Probab=95.69  E-value=0.036  Score=31.38  Aligned_cols=40  Identities=10%  Similarity=0.198  Sum_probs=18.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHH
Q ss_conf             809995889986899999999999759994999916046569999
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWT   63 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~   63 (458)
T Consensus       168 GvLLyGPPGtGKTllAkAvA~e~----~~~fi~v~~s~l~-sk~v  207 (390)
T PRK03992        168 GVLLYGPPGTGKTLLAKAVAHET----NATFIRVVGSELV-QKFI  207 (390)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH----CCCEEEEEHHHHH-HCCC
T ss_conf             27868989997899999999874----8887996679975-2454