HHsearch alignment for GI: 255764515 and conserved domain: PRK05298

>PRK05298 excinuclease ABC subunit B; Provisional.
Probab=99.31  E-value=9.4e-10  Score=77.34  Aligned_cols=86  Identities=13%  Similarity=0.094  Sum_probs=64.1

Q ss_pred             CCCCEEEEHHHHHHHHHHHHHC----------CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEE
Q ss_conf             4884034222367888664100----------026533445899876424588558998442211162200178599990
Q gi|255764515|r  319 ANAAPIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFF  388 (458)
Q Consensus       319 ~~~~kviif~~~~~~~~~i~~~----------~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~  388 (458)
T Consensus       444 ~~~er~LvttlTkkmaEdLt~yl~~~~ik~~YlHs~i~t~eR~eIl~~LR~G~~DVlVG-INLLREGLDlPEV-SLVaIL  521 (657)
T PRK05298        444 AKGERVLVTTLTKRMAEDLTDYLKELGIKVRYLHSDIDTLERVEIIRDLRLGEFDVLVG-INLLREGLDIPEV-SLVAIL  521 (657)
T ss_pred             HCCCEEEEEECHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCEEEE-ECHHHCCCCCCCE-EEEEEE
T ss_conf             36976999954598999999999967980799626661889999999985888758975-0022045787613-579887


Q ss_pred             CC-----CCCHHHHHHHHHHHHC
Q ss_conf             89-----9898686445666620
Q gi|255764515|r  389 SL-----WWDLEEHQQMIERIGV  406 (458)
Q Consensus       389 ~~-----~wn~~~~~Q~~gRi~~  406 (458)
T Consensus       522 DADKeGFLRs~~SLiQtiGRAAR  544 (657)
T PRK05298        522 DADKEGFLRSERSLIQTIGRAAR  544 (657)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             06852210352059999878862