HHsearch alignment for GI: 255764515 and conserved domain: PRK05580

>PRK05580 primosome assembly protein PriA; Validated.
Probab=99.52  E-value=8.1e-11  Score=83.79  Aligned_cols=152  Identities=19%  Similarity=0.128  Sum_probs=99.6

Q ss_pred             CCCHHHHHHHHHHHHC---CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             8747899999999967---9809995889986899999999999759994999916046569999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDH---KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~---~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~   78 (458)
T Consensus       168 ~L~~eQ~~a~~~i~~~~~~~~~LL~GvTGSGKTevYl~li~~~l~~G-kqvLiLvPEI~lt~q~~~rl~~~fg---~~v~  243 (699)
T PRK05580        168 TLNEEQAAALAAIRAAGGFSAFLLDGVTGSGKTEVYLQAIAEALAQG-KQALVLVPEIALTPQLLARFRARFG---ARVA  243 (699)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHHCC-CCEEEEECCHHHHHHHHHHHHHHHC---CCEE
T ss_conf             88999999999998558887178747898607999999999999739-9789991767878999999998709---9579


Q ss_pred             EEEC--CHHHHHHHH----CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCC--CCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             9858--978988873----0779869980642023344200011322044045310--0246543115677776654305
Q gi|255764515|r   79 VITG--TVKQRTKVL----KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTK--LKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        79 ~~~g--~~~~r~~~~----~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~--lkn~~~~~~s~~~~~l~~~~~~  150 (458)
T Consensus       244 v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRSAvF------aP~~nLgLIIVDEEhd~SYKq~~~Pry~ARdvA~~Ra~~~  317 (699)
T PRK05580        244 VLHSGLSDGERYRAWLAALRGEARVVIGTRSALF------APFKNLGLIIVDEEHDDSYKQQDGPRYHARDVAVLRAKQE  317 (699)
T ss_pred             EECCCCCHHHHHHHHHHHHCCCCEEEEECCCEEE------CCCCCCCEEEEECCCCHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             9648898579999999997699719997360110------6578984899973654544466687611999999999984


Q ss_pred             CCEEEEECCCCHH
Q ss_conf             9807996584023
Q gi|255764515|r  151 SERFIELTGTPSP  163 (458)
Q Consensus       151 ~~~~l~LTgTPi~  163 (458)
T Consensus       318 ~~~liLgSaTPSl  330 (699)
T PRK05580        318 GCPVVLGSATPSL  330 (699)
T ss_pred             CCCEEECCCCCCH
T ss_conf             9988961689999