HHsearch alignment for GI: 255764515 and conserved domain: PRK05896

>PRK05896 DNA polymerase III subunits gamma and tau; Validated.
Probab=97.43  E-value=0.0026  Score=38.29  Aligned_cols=107  Identities=14%  Similarity=0.143  Sum_probs=51.9

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEE
Q ss_conf             099958899868999999999997-5999499991604656999999998558888159998589789888730779869
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLY   98 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~   98 (458)
T Consensus        41 YLFsGPrGvGKTTlArifAkaLnC~~~~~~d----pCg~-----C~sC~~I~~g~h~DviEIdaasn~gI----------  101 (613)
T PRK05896         41 YIFSGPRGIGKTSIAKIFAKAINCLNPKDGD----CCNS-----CSVCESINTNQSVDIVELDAASNNGV----------  101 (613)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCC----CCCC-----CHHHHHHHCCCCCCEEEEECCCCCCH----------
T ss_conf             7755899848899999999996699999999----8888-----87899985699998688406555788----------


Q ss_pred             EECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEE
Q ss_conf             98064202334420---00113220440453100246543115677776654305-980799
Q gi|255764515|r   99 VINFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFIE  156 (458)
Q Consensus        99 i~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l~  156 (458)
T Consensus       102 ----DeIReLie~~~~~P~~gkyKV~IIDEah~Ln-------~~AaNALLKtLEEPP~~viF  152 (613)
T PRK05896        102 ----DEIRNIIDNINYLPTTFKYKVYIIDEAHMLS-------TSAWNALLKTLEEPPKHVVF  152 (613)
T ss_pred             ----HHHHHHHHHHCCCCCCCCCEEEEECCHHHCC-------HHHHHHHHHHCCCCCCCCEE
T ss_conf             ----9999999970858757994599981622179-------99999999853489878379