HHsearch alignment for GI: 255764515 and conserved domain: PRK06731

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=91.57  E-value=0.86  Score=23.05  Aligned_cols=33  Identities=27%  Similarity=0.226  Sum_probs=23.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             0999588998689999999999975999499991
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
T Consensus        78 I~lvG~~G~GKTTT~AKLA~~~~~~~-~kV~lia  110 (270)
T PRK06731         78 IALIGPTGVGKTTTLAKMAWQFHGKK-KTVGFIT  110 (270)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEE
T ss_conf             99988898988999999999998679-9089998