HHsearch alignment for GI: 255764515 and conserved domain: PRK08760

>PRK08760 replicative DNA helicase; Provisional.
Probab=91.69  E-value=0.83  Score=23.13  Aligned_cols=42  Identities=14%  Similarity=0.208  Sum_probs=18.1

Q ss_pred             CCCCCEEEEECCC--CCHHHHH-HHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             0178599990899--8986864-456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSLW--WDLEEHQ-QMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~~--wn~~~~~-Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
T Consensus       413 qdA-DvV~~l~R~~~y~~~~~~~~~~~e~i-vaKnR~G~~G~v~l~f  457 (476)
T PRK08760        413 QDA-DMIVFIYRDDYYNKENSPDKGLAEII-IGKHRGGPTGSCKLKF  457 (476)
T ss_pred             HCC-CEEEEECCHHHCCCCCCCCCCEEEEE-EECCCCCCCCEEEEEE
T ss_conf             208-68999624532387679888807999-9746789862699998