HHsearch alignment for GI: 255764515 and conserved domain: PRK09111

>PRK09111 DNA polymerase III subunits gamma and tau; Validated.
Probab=95.11  E-value=0.21  Score=26.72  Aligned_cols=113  Identities=13%  Similarity=0.146  Sum_probs=58.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCC----CCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCC
Q ss_conf             09995889986899999999999759----99499991604656999999998558888159998589789888730779
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA   95 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~----~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~   95 (458)
T Consensus        48 ~l~~g~rg~gktt~ari~a~~lnc~~~~~~~~~~~--~~c~~c~~--c~~i~---~~~~~d~~e~daas~~~v~~~----  116 (600)
T PRK09111         48 FMLTGVRGVGKTTTARILARALNYKGPDGVGGPTI--DPCGVGEH--CQAIM---EGRHVDVIEMDAASHTGVDDI----  116 (600)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC--CCCCCCHH--HHHHH---CCCCCCEEEEECCCCCCHHHH----
T ss_conf             76457898789999999999966988766689988--98998865--89886---689987588515545788899----


Q ss_pred             CEEEECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH-CCCEEEEECCC
Q ss_conf             8699806420233442---00011322044045310024654311567777665430-59807996584
Q gi|255764515|r   96 VLYVINFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGT  160 (458)
Q Consensus        96 ~i~i~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~-~~~~~l~LTgT  160 (458)
T Consensus       117 ----------r~~~~~~~~~p~~~~~kv~iidevhmls-------~~afnallktleepp~~~~fi~at  168 (600)
T PRK09111        117 ----------REIIESVRYRPVSARYKVYIIDEVHMLS-------TAAFNALLKTLEEPPPHVKFIFAT  168 (600)
T ss_pred             ----------HHHHHHHCCCCCCCCEEEEEEECCCCCC-------HHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             ----------9999860538877754699960011057-------999999998762598654999962