HHsearch alignment for GI: 255764515 and conserved domain: PRK09183

>PRK09183 transposase/IS protein; Provisional.
Probab=97.11  E-value=0.0074  Score=35.54  Aligned_cols=49  Identities=14%  Similarity=0.074  Sum_probs=37.5

Q ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             99999967980999588998689999999999975999499991604656
Q gi|255764515|r   10 IVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus        10 ~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
T Consensus        94 ~~~fi~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G-~~v~f~~~~~L~~  142 (258)
T PRK09183         94 SLSFIERNENIVLLGPSGVGKTHLAIALGYEAVRAG-IKVRFTTAADLLL  142 (258)
T ss_pred             CCCHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEHHHHHH
T ss_conf             581665588679989999868999999999999879-9399978999999