HHsearch alignment for GI: 255764515 and conserved domain: PRK10490

>PRK10490 sensor protein KdpD; Provisional.
Probab=93.10  E-value=0.55  Score=24.21  Aligned_cols=107  Identities=14%  Similarity=0.080  Sum_probs=51.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHH-HHHCCCCCCEEEEEECCHHHHHHHHCCCCCE
Q ss_conf             809995889986899999999999759994999916046569999999-9855888815999858978988873077986
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEV-QRWSNFSHMNISVITGTVKQRTKVLKTPAVL   97 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei-~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i   97 (458)
T Consensus        26 ki~lg~a~gvGKty~mL~~a~~~~~~g~dvvvg~ve~h~r~e--t~~l~~gl~~~p-~~~~~y~g~~-------------   89 (895)
T PRK10490         26 KVFFGACAGVGKTWAMLAEAQRLRAQGLDVVVGVVETHGRKE--TAALLEGLTVLP-PKRLAHRGRQ-------------   89 (895)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHH--HHHHHCCCCCCC-CCEEEECCCC-------------
T ss_conf             899426999868999999999999779947999961799689--999874866588-7114127832-------------


Q ss_pred             EEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9980642023344200011322044045310024654311567777665430
Q gi|255764515|r   98 YVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        98 ~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
T Consensus        90 ----~~e~--dlda~l~-r~P~~~lvDelaht-n~pgsrh~kR~qdv~ell~  133 (895)
T PRK10490         90 ----ISEF--DLDAALA-RRPALILMDELAHS-NAPGSRHPKRWQDIEELLE  133 (895)
T ss_pred             ----CCCC--CHHHHHH-CCCCEEEEECCCCC-CCCCCCCCCHHHHHHHHHH
T ss_conf             ----3416--8989985-39988997334566-9998877640764999997