HHsearch alignment for GI: 255764515 and conserved domain: PRK11664

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional.
Probab=99.07  E-value=1.8e-08  Score=69.61  Aligned_cols=154  Identities=15%  Similarity=0.147  Sum_probs=74.4

Q ss_pred             HHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCCCCCEEEEECCHHHHH---HHHHHHHHHCCCCC--CEEEEEEC
Q ss_conf             99999996798099958899868999-99999999759994999916046569---99999998558888--15999858
Q gi|255764515|r    9 KIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWGEKSVLVIAPLRVAQS---VWTSEVQRWSNFSH--MNISVITG   82 (458)
Q Consensus         9 ~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~~~~~LIv~P~~l~~~---~W~~Ei~kf~~~~~--~~~~~~~g   82 (458)
T Consensus        12 ~i~~~l~~~~~~vl~a~tGsGKtTqvP~~ll~~~~--~~g~I~~~qPRR~AA~s~A~RvA~e--~~e~~G~~VGY~vR~e   87 (812)
T PRK11664         12 ELLTALKTAPQVLLKAPTGAGKSTWLPLQLLQQGG--INGKIIMLEPRRLAARNVAQRLAEQ--LGEKPGETVGYRMRAE   87 (812)
T ss_pred             HHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHCCC--CCCCEEEECCHHHHHHHHHHHHHHH--HCCCCCCEEEEEECCC
T ss_conf             99999997997999908999989999999996468--8993899388399999999999997--2999998675782567


Q ss_pred             CHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH---HCCCEEEEECC
Q ss_conf             978988873077986998064202334420001132204404531002465431156777766543---05980799658
Q gi|255764515|r   83 TVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA---WESERFIELTG  159 (458)
Q Consensus        83 ~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~---~~~~~~l~LTg  159 (458)
T Consensus        88 ~-~-----~s~~Tri~~~T~GiLlr~l~~dp~L~~~~~vI~DE~HER-~---l~~Dl~l~l~~~~~~~~r~dLklvvMSA  157 (812)
T PRK11664         88 S-K-----VGPNTRLEVVTEGILTRMIQRDPELSGVGLVILDEFHER-S---LQADLALALLLDVQQGLRDDLKLLIMSA  157 (812)
T ss_pred             C-C-----CCCCCEEEEECHHHHHHHHHHCCCCCCCCEEEEECCCCC-C---HHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             7-8-----899857999755899999724977677888999575468-7---5189999999999986189828999847


Q ss_pred             CCHHHHCCCHHHHHHHC
Q ss_conf             40231001013467751
Q gi|255764515|r  160 TPSPNGLIDLWGQIWFL  176 (458)
Q Consensus       160 TPi~n~~~el~~ll~~l  176 (458)
T Consensus       158 Tld~~~~~~~~~~~~~i  174 (812)
T PRK11664        158 TLDNDRLQQLLPDAPYI  174 (812)
T ss_pred             CCCHHHHHHHCCCCCEE
T ss_conf             88848899758999889