HHsearch alignment for GI: 255764515 and conserved domain: PRK11747

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional.
Probab=95.37  E-value=0.093  Score=28.89  Aligned_cols=79  Identities=16%  Similarity=0.180  Sum_probs=44.9

Q ss_pred             CHHHHHHCCCCCEEEEHHHHHHH---HHHHHH-----CCCCCCCHHHHHHHHH----HHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             25665412488403422236788---866410-----0026533445899876----42458855899844221116220
Q gi|255764515|r  311 ALEVIIEKANAAPIIVAYHFNSD---LARLQK-----AFPQGRTLDKDPCTIQ----EWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       311 ~l~~il~~~~~~kviif~~~~~~---~~~i~~-----~~~~g~~~~~r~~~i~----~f~~~~~~vli~s~~~~~~GlnL  378 (458)
T Consensus       526 ~i~~~~~~~~g-~LVLFtS~~~l~~v~~~l~~~~~~~ll~Qg~--~~r~~ll~~f~~~~~~~~~svLlGt-~SFwEGVD~  601 (697)
T PRK11747        526 YLPELLEGHKG-SLVLFSSRRQMQKVADLLPGDLRLLLLVQGE--QPRQELLEKHKKRVDEGEGSVLFGL-QSFAEGLDL  601 (697)
T ss_pred             HHHHHHHHCCC-EEEEECHHHHHHHHHHHHHHHCCCCEEEECC--CCHHHHHHHHHHHHHCCCCEEEEEC-CCCCCCEEC
T ss_conf             99999985698-4999501999999999876634883899568--6599999999998616898299967-531266136


Q ss_pred             CC-CCCEEEEECCCCC
Q ss_conf             01-7859999089989
Q gi|255764515|r  379 QY-GGNILVFFSLWWD  393 (458)
Q Consensus       379 ~~-a~~~iI~~~~~wn  393 (458)
T Consensus       602 pG~~L~~VII~kLPF~  617 (697)
T PRK11747        602 PGDYLTQVIITKIPFA  617 (697)
T ss_pred             CCCCEEEEEEECCCCC
T ss_conf             9878789999748999