HHsearch alignment for GI: 255764515 and conserved domain: PRK12377

>PRK12377 putative replication protein; Provisional.
Probab=97.22  E-value=0.0057  Score=36.26  Aligned_cols=54  Identities=17%  Similarity=0.125  Sum_probs=36.6

Q ss_pred             HHHHHHHHH--------HHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             789999999--------9967980999588998689999999999975999499991604656
Q gi|255764515|r    5 PHQTKIVDW--------ILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus         5 p~Q~~~v~~--------~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
T Consensus        81 ~~~~~a~~~a~~~~~~F~~~~~NlIf~G~pGtGKTHLA~AIg~~a~~~G-~sVlF~t~~dLv~  142 (248)
T PRK12377         81 DGQRYALSQAKSIADELMTGCTNFVFSGKPGTGKNHLAAAIGNRLLAKG-RSVIVVTVPDVMS  142 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEHHHHHH
T ss_conf             7899999999999998731886089989999878899999999999879-9699988999999