HHsearch alignment for GI: 255764515 and conserved domain: PRK12900

>PRK12900 secA preprotein translocase subunit SecA; Reviewed.
Probab=98.37  E-value=0.00017  Score=45.42  Aligned_cols=123  Identities=18%  Similarity=0.277  Sum_probs=69.7

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160465---69999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~~   78 (458)
T Consensus        92 ~m~~ydvQliGg~~Lh~G~IaEM~TGEGKTLvatlp-~ylnaL~GkgvHvvTvNdYLA~RDae~m~~vy~fL---Glsvg  167 (983)
T PRK12900         92 DMVPYDVQLIGGIVLHSGKISEMATGEGKTLVSTLP-TFLNALTGRGVHVVTVNDYLAQRDKEWMNPVFEFH---GLSVG  167 (983)
T ss_pred             CCCCCCHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEECCCHHHHHHHHHHHHHHHHHH---CCEEE
T ss_conf             677774699979998368314551788589999999-99986369982898145676786799999999984---97770


Q ss_pred             EEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC------CCCCCCCEEECCCCCCC
Q ss_conf             9858--9789888730779869980642-02334420------00113220440453100
Q gi|255764515|r   79 VITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL------KGTWPFATIVVDESTKL  129 (458)
Q Consensus        79 ~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~------~~~~~~~~iIiDEaH~l  129 (458)
T Consensus       168 ~i~~~~~~~err~aY~~D-ItYgTn~E~gFDYLRDnm~~~~~~~vqr~~~~aIVDEvDSi  226 (983)
T PRK12900        168 VILNSMRPEERREQYLCD-ITYGTNNEFGFDYLRDNMAGSPEEMVQRDFYFAIVDEVDSV  226 (983)
T ss_pred             EECCCCCHHHHHHHHCCC-CEEECCCCCCCCCCHHCCCCCHHHHCCCCCCEEEEECHHHH
T ss_conf             308999989999987599-57878985424021004477868842788855898441566