HHsearch alignment for GI: 255764515 and conserved domain: PRK12904

>PRK12904 preprotein translocase subunit SecA; Reviewed.
Probab=98.74  E-value=1.3e-05  Score=52.29  Aligned_cols=124  Identities=16%  Similarity=0.263  Sum_probs=69.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
T Consensus        78 lg~~~~dvQl~gg~~l~~g~iaEM~TGEGKTL~atlp-~ylnal~g~gvhvvTvNdYLA~RDa~~m~~~~~~l---Gltv  153 (833)
T PRK12904         78 LGMRHFDVQLIGGMVLHEGKIAEMKTGEGKTLVATLP-AYLNALTGKGVHVVTVNDYLAKRDAEWMGPLYNFL---GLSV  153 (833)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEECCCCHHHHHHHH-HHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             5897647899989999469524650688589999999-99997369981998155577787799999999981---9788


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
T Consensus       154 g~i~~~~~~~~r~~aY~~d-itY~tn~e~gFDyLrDnm~~~~~~~v~r~~~~aivDE~DSi  213 (833)
T PRK12904        154 GVILSGMSPEERREAYAAD-ITYGTNNEFGFDYLRDNMVFSLEDRVQRGLNYAIVDEVDSI  213 (833)
T ss_pred             EEECCCCCHHHHHHHHHCC-EEEECCCCCCCCCCCCCCCCCHHHHHHHCCCEEEEECCHHH
T ss_conf             0438999839999986377-13412543245412555437889875012572688641132